Abhd5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABHD5. Source: E. coli
Amino Acid Sequence: MTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ABHD5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84507. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Abhd5 Recombinant Protein Antigen
Background
Abhydrolase domain containing 5 (ABHD5) belongs to a very large protein family which contains an alpha/beta hydrolase fold. ABHD5 also contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. Abhd 5 is distinct from other members of this subfamily because the putative catalytic triad contains an asparagine rather than a serine residue.
ABHD5 is a lysophosphatidic acid acyltransferase with a role in phosphatidic acid biosynthesis. ABHD5 may also help regulate cellular storage of triacylglycerol by activating the phospholipase PNPLA2. Additionaly, the ABHD5 protein is thought to play a role in keratinocyte differentiation.
Mutations in this gene are associated with Chanarin-Dorfman syndrome, a triglyceride storage disease characterized by impaired oxidation of long-chain fatty acids. Abhd5 is expressed in many tissues, including brain, liver, skin, skeletal muscle and lymphocytes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Abhd5 Protein (NBP1-84507PEP) (0)
There are no publications for Abhd5 Protein (NBP1-84507PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Abhd5 Protein (NBP1-84507PEP) (0)
There are no reviews for Abhd5 Protein (NBP1-84507PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Abhd5 Protein (NBP1-84507PEP) (0)
Additional Abhd5 Products
Research Areas for Abhd5 Protein (NBP1-84507PEP)
Find related products by research area.
|
Blogs on Abhd5