Recombinant Human ABCG1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related ABCG1 Peptides and Proteins

Order Details


    • Catalog Number
      H00009619-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ABCG1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 21-130 of Human ABCG1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABCG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABCG1 GST (N-Term) Protein

  • ABC transporter 8
  • ABC8
  • ABCG1
  • ATP-binding cassette sub-family G member 1
  • ATP-binding cassette transporter 8
  • ATP-binding cassette transporter member 1 of subfamily G
  • ATP-binding cassette, sub-family G (WHITE), member 1
  • homolog of Drosophila white
  • MGC34313
  • white protein homolog (ATP-binding cassette transporter 8)
  • White protein homolog
  • WHITE1
  • WHT1

Background

ABCG1 (ATP-binding cassette sub-family G member 1) is a member of the ABC superfamily of transporters, specifically the ABCG (White) subfamily, that is characterized by their ABC domain organization (1). The ABC domains are around 180 amino acids (aa) in length and contain three conserved domains: Walker A motif (12 aa), Walker B motif (5 aa), and Signature motif (5 aa) (1, 2). Functional ABC transporters are comprised of two ABCs and two transmembrane domains (TMDs), where each TMD contains six TM alpha-helices (1-3). ABCG1 is considered a "half" transporter because it only has one ABC domain and one TMD (1-3). In order to be functional, ABCG1 and other half transporters can form homodimers or heterodimers (1-3). ABCG1 has a theoretical molecular weight of 102 kDa and is highly expressed in cells including macrophages, lymphocytes, and neurons (2). Additionally, ABCG1 is shown to be highly expressed in lung, kidney, brain, and spleen tissue (2). Specifically, ABCG1 is presented on the cell surface and in intracellular compartments of cholesterol-rich macrophages and, consequently, plays a crucial role in cholesterol regulation and homeostasis (3-5). ABCG1 is involved in the export, or efflux, of cholesterol and phospholipids from macrophages to high density lipoproteins (HDL) for eventual excretion via the liver.

A variety of cardiovascular and cardiometabolic diseases are associated with ABCG1 dysfunction (5-7). Macrophages can become cholesterol-containing foam cells that are generated by the uptake of low-density lipoproteins (LDL), cholesterol esterification, and compromised cholesterol efflux machinery in transporters like ABCG1 and ABCA1 (2, 5, 6, 7). Foam cells are associated with the chronic, inflammatory disease atherosclerosis which is characterized by arterial buildup of plaques that can ultimately lead to cardiovascular disease (5, 6, 7). Additionally, ABCG1 has a critical role in cardiometabolic disorders. Studies have found that diabetic mice have decreased ABCG1 expression (8). Furthermore, loss of ABCG1 in mouse pancreatic beta cells ultimately leads to impaired insulin secretion, suggesting that inhibition or modulation of ABCG1 may contribute to development of diabetes and obesity (8). Finally, other related ATP-binding cassette transporter family members, such as ABCA1 and ABCG5/8, have been associated with genetically-inherited syndromes like Tangier disease, characterized by reduced levels of HDL in the blood, and Sitosterolemia, characterized by elevated plant sterol lipid accumulation in blood and tissues (7). .

Alternate names for ABCG1 includes ABC transporter 8 (ABC8), ATP-binding cassette transporter, anti-, sub-family G (WHITE), homolog of Drosophila white, and MGC34313. .

References

1. Tarling E. J. (2013). Expanding roles of ABCG1 and sterol transport. Current opinion in lipidology. https://doi.org/10.1097/MOL.0b013e32835da122.

2. Tarr, P. T., Tarling, E. J., Bojanic, D. D., Edwards, P. A., & Baldan, A. (2009). Emerging new paradigms for ABCG transporters. Biochimica et biophysica acta.https://doi.org/10.1016/j.bbalip.2009.01.007.

3. Tarling, E. J., & Edwards, P. A. (2011). ATP binding cassette transporter G1 (ABCG1) is an intracellular sterol transporter. Proceedings of the National Academy of Sciences of the United States of America. https://doi.org/10.1073/pnas.1113021108.

4. Phillips M. C. (2014). Molecular mechanisms of cellular cholesterol efflux. The Journal of biological chemistry, 289(35), 24020-24029. https://doi.org/10.1074/jbc.R114.583658.

5. Ouimet, M., Barrett, T. J., & Fisher, E. A. (2019). HDL and Reverse Cholesterol Transport. Circulation research. https://doi.org/10.1161/CIRCRESAHA.119.312617.

6. Yu, X. H., Fu, Y. C., Zhang, D. W., Yin, K., & Tang, C. K. (2013). Foam cells in atherosclerosis. Clinica chimica acta; international journal of clinical chemistry. https://doi.org/10.1016/j.cca.2013.06.006

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-23488
Species: Hu
Applications: ELISA, Flow, ICC/IF (-), IHC,  IHC-P, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP3-41376
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB

Publications for ABCG1 Partial Recombinant Protein (H00009619-Q01) (0)

There are no publications for ABCG1 Partial Recombinant Protein (H00009619-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCG1 Partial Recombinant Protein (H00009619-Q01) (0)

There are no reviews for ABCG1 Partial Recombinant Protein (H00009619-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCG1 Partial Recombinant Protein (H00009619-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCG1 Products

Research Areas for ABCG1 Partial Recombinant Protein (H00009619-Q01)

Find related products by research area.

Blogs on ABCG1.

ABCA1 (ATP-binding cassette transporter A1)
The ABCA1 molecule is a primary gatekeeper for regulating the intracellular transport of cholesterol. It belongs to a larger related multifamily of cAMP-dependent anion transporter cell membrane molecules. These key proteins are responsible for tr...  Read full blog post.

ABCA1 - The Caretaker for Cholesterol Transportation
The ATP-binding cassette transporter A1 (ABCA1) protein is a key gatekeeper for regulating intracellular cholesterol transport. It is one member of a large family of genes comprised of cAMP-dependent anion transporter cell membrane proteins. These imp...  Read full blog post.

ABCG1: Easy as 123
ABCG1 (ATP-binding cassette sub-family G member 1) is a transporter protein that is primarily involved in macrophage lipid homeostasis. It is a member of the superfamily of ATP-binding cassette (ABC) transporters and localizes to intracellular compart...  Read full blog post.

ABCG2: A Tumor Protector
ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily. Among ABC transporters ABCG2 is particularly interesting for its potential role in protecting cancer stem cells and its complex oligomeric structure (1). The ABC transporters...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABCG1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCG1