ABCF2 Antibody

Images

 
Western Blot: ABCF2 Antibody [NBP1-89318] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MCF-7
Immunohistochemistry: ABCF2 Antibody [NBP1-89318] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCF2 Protein (NBP1-89318PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCF2 Antibody

  • ABC28
  • ABC-type transport protein
  • ATP-binding cassette sub-family F member 2
  • ATP-binding cassette, sub-family F (GCN20), member 2
  • DKFZp586K1823
  • EC 3.6.3
  • EC 3.6.3.17
  • EST133090
  • HUSSY18
  • HUSSY-18
  • Iron inhibited ABC transporter 2
  • Iron-inhibited ABC transporter 2
  • M-ABC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-93466
Species: Hu, Mu
Applications: ICC/IF, IP, PEP-ELISA
NB400-116
Species: Hu
Applications: WB, ICC/IF, IP
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-84781
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS

Publications for ABCF2 Antibody (NBP1-89318) (0)

There are no publications for ABCF2 Antibody (NBP1-89318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCF2 Antibody (NBP1-89318) (0)

There are no reviews for ABCF2 Antibody (NBP1-89318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCF2 Antibody (NBP1-89318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCF2 Products

Bioinformatics Tool for ABCF2 Antibody (NBP1-89318)

Discover related pathways, diseases and genes to ABCF2 Antibody (NBP1-89318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCF2 Antibody (NBP1-89318)

Discover more about diseases related to ABCF2 Antibody (NBP1-89318).
 

Pathways for ABCF2 Antibody (NBP1-89318)

View related products by pathway.

PTMs for ABCF2 Antibody (NBP1-89318)

Learn more about PTMs related to ABCF2 Antibody (NBP1-89318).
 

Research Areas for ABCF2 Antibody (NBP1-89318)

Find related products by research area.

Blogs on ABCF2.

Cancer studies with ABCF2
ATP-binding cassette superfamily F2 (ABCF2) is a member of the ATP-binding cassette (ABC) transporter superfamily, and more specifically, a member of the GCN20 subfamily. Most members of this family are membrane proteins that transport various substra...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCF2