ABCC11 Antibody (4H6)

Images

 
Immunocytochemistry/ Immunofluorescence: ABCC11 Antibody (4H6) [H00085320-M02] - Analysis of monoclonal antibody to ABCC11 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: ABCC11 Antibody (4H6) [H00085320-M02] - Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF, S-ELISA
Clone
4H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ABCC11 Antibody (4H6) Summary

Immunogen
ABCC11 (NP_115972.2, 433 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL
Specificity
ABCC11 - ATP-binding cassette, sub-family C (CFTR/MRP), member 11 (4H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABCC11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00085320-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABCC11 Antibody (4H6)

  • ATP-binding cassette protein C11
  • ATP-binding cassette transporter MRP8
  • ATP-binding cassette transporter sub-family C member 11
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 11
  • EWWD
  • MRP8ATP-binding cassette sub-family C member 11
  • Multidrug resistance-associated protein 8
  • multi-resistance protein 8
  • WW

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46467
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87103
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51541
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-20945
Species: Hu, Mu, Rt, Bv, Ca
Applications: PEP-ELISA
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCC11 Antibody (H00085320-M02)(1)

Reviews for ABCC11 Antibody (H00085320-M02) (0)

There are no reviews for ABCC11 Antibody (H00085320-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCC11 Antibody (H00085320-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABCC11 Products

Bioinformatics Tool for ABCC11 Antibody (H00085320-M02)

Discover related pathways, diseases and genes to ABCC11 Antibody (H00085320-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC11 Antibody (H00085320-M02)

Discover more about diseases related to ABCC11 Antibody (H00085320-M02).
 

Pathways for ABCC11 Antibody (H00085320-M02)

View related products by pathway.

PTMs for ABCC11 Antibody (H00085320-M02)

Learn more about PTMs related to ABCC11 Antibody (H00085320-M02).

Blogs on ABCC11

There are no specific blogs for ABCC11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCC11 Antibody (4H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC11
Entrez
Uniprot