Home » ABCB6 » ABCB6 Antibodies » ABCB6 Antibody

ABCB6 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ABCB6 Antibody [NBP2-58327] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Western Blot: ABCB6 Antibody [NBP2-58327] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Orthogonal Strategies: Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ABCB6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD
Specificity
Specificity of human ABCB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABCB6 Antibody

  • ABC
  • ABC14
  • ABCB6
  • ATP-binding cassette, sub-family B (MDR/TAP), member 6
  • EC 3.6.3
  • EST45597
  • FLJ22414
  • LAN
  • MCOPCB7
  • Mitochondrial ABC transporter 3
  • mitochondrial
  • MTABC3
  • MTABC3ABC14
  • P-glycoprotein-related protein
  • PRP
  • Umat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prion protein
Antibody (SC57-05)
NBP2-67569
Western Blot: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of PrP on different lysates using anti-PrP antibody at 1/1,000 dilution. Positive control: Lane 1: Rat brain Lane 2: Mouse brain
Immunocytochemistry/Immunofluorescence: Prion protein Antibody (SC57-05) [NBP2-67569] - Staining PrP in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of paraffin-embedded rat brain tissue using anti-PrP antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract7.5% SDS-PAGE GALNS antibody dilution: 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraformaldehyde-fixed HeLa, using GALNS antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
Immunohistochemistry-Paraffin: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:100 dilution.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ABCG2/CD338
Antibody (3G8)
NBP2-22124
Western Blot: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of ABCG2 expression in (1) human small intestine, (2) human placenta and (3) mouse placenta tissue extracts.
Immunocytochemistry/Immunofluorescence: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of Hela cells using ABCG2 mouse mAb (green). DRAQ5 fluorescent DNA dye (blue). Actin filaments have been labeled with Alexa Fluor-555 phalloidin (red).
Immunohistochemistry-Paraffin: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of paraffin-embedded bladder cancer tissues (left) and skeletal muscle tissues (right) using ABCG2 mouse mAb with DAB staining.
(3 Publications)
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MDR1/ABCB1 Antibody
NB100-80870
Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
MRP1 Antibody
(IU2H10)
NB400-156
Western Blot: MRP1 Antibody (IU2H10) [NB400-156] - Vector-transfected HEK293 cells 2: MRP1-transfected cells, prep1 3: MRP1-transfected cells, prep2 (the lower band is a degradation product.)
Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU2H10) [NB400-156] - The MRP-1 antibody was tested in HeLa cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
MRP2 Antibody
(JA32-01)
NBP2-66958
Immunocytochemistry/Immunofluorescence: MRP2 Antibody (JA32-01) [NBP2-66958] - Staining MRP2 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MRP2 Antibody (JA32-01) [NBP2-66958] - Analysis of paraffin-embedded human liver tissue using anti-MRP2 antibody. Counter stained with hematoxylin.
Flow Cytometry: MRP2 Antibody (JA32-01) [NBP2-66958] - Analysis of A549 cells with MRP2 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(39 Publications)
Species: Hu
Applications: WB, IHC, IP
ASAH1 Antibody
NBP1-89296
Western Blot: ASAH1 Antibody [NBP1-89296] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
(6 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
MSH3 Antibody
NBP2-19417
Western Blot: MSH3 Antibody [NBP2-19417] - H1299 whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with MSH3 antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MSH3 Antibody [NBP2-19417] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: MSH3 Antibody [NBP2-19417] - Immunohistochemical analysis of paraffin-embedded Colon carcinoma, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MDMX Antibody
NB100-556
Western Blot: MDMX Antibody [NB100-556] - Detection of human HdmX/MDM4 by western blot. Samples: Whole cell lysate (50 ug) from Jurkat, HEK293T, and HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-HdmX/MDM4 antibody NB100-556 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Western Blot: MDMX Antibody [NB100-556] - Samples: Whole cell lysate (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) from Jurkat cells. Antibodies: Affinity purified rabbit anti-HdmX/MDM4 antibody NB100-556 (lot 2) used for WB at 1 ug/ml (A and B) and used for IP at 6 ug/mg lysate. HdmX/MDM4 was also immunoprecipitated by a previous lot (NB100-556 lot 1) of this antibody. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 10 seconds (B).
Western Blot: MDMX Antibody [NB100-556] - Analysis using the Biotin conjugate of NB100-556. Detection of Jurkat (50, 15, and 5 ug). Antibody used at 1.0 ug/ml. Detection: Streptavidin-HRP and chemiluminescence with an exposure time of 30 seconds.
(32 Publications)
Species: Hu
Applications: WB, IP
TBC1D9 Antibody
NBP2-13415
Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Doppel Antibody
NBP2-31928
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining in human testis and endometrium tissues using anti-PRND antibody. Corresponding PRND RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
ABCA1 Antibody
NB400-105
Western Blot: ABCA1 Antibody [NB400-105] - Western Blot analysis of ABCA1 in total cell lysates of RAW264.9 cells treated with vehicle (-) or 9-cisretinoic acid and 22Rhydroxycholesterol (+). Samples used for this testing were 40 ug of total cell post-nuclear lysate from each group.
Western Blot: ABCA1 Antibody [NB400-105] - Detection of ABCA1 in mouse peritoneal macrophages using NB 400-105 (Lot L). ECL exposure, 1 min. Lane 4: T09 uninduced lysate Lane 5: T09 induced lysate.
Immunocytochemistry/Immunofluorescence: ABCA1 Antibody [NB400-105] - Untreated HepG2 cells were grown to 60% confluency, and serum starved for 24 hours prior to being fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ABCA1 at 5.0ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(6 Reviews)
(305 Publications)
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, GS, PCR
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(24 Reviews)
(589 Publications)
Species: Hu
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [1761].
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
MARCKS like
protein Antibody
NBP2-38160
Immunocytochemistry/Immunofluorescence: MARCKS like protein Antibody [NBP2-38160] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry: MARCKS like protein Antibody [NBP2-38160] - Staining of human lymph node shows strong cytoplasmic positivity in both germinal center cells and non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GPR177/WLS Antibody
NBP2-57299
Western Blot: GPR177/WLS Antibody [NBP2-57299] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GPR177/WLS Antibody [NBP2-57299] - Staining of human placenta shows strong cytoplasmic positivity in cytotrophoblastic cells.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ABCB6 Antibody (NBP2-58327) (0)

There are no publications for ABCB6 Antibody (NBP2-58327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB6 Antibody (NBP2-58327) (0)

There are no reviews for ABCB6 Antibody (NBP2-58327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCB6 Antibody (NBP2-58327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ABCB6 Products

Bioinformatics Tool for ABCB6 Antibody (NBP2-58327)

Discover related pathways, diseases and genes to ABCB6 Antibody (NBP2-58327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB6 Antibody (NBP2-58327)

Discover more about diseases related to ABCB6 Antibody (NBP2-58327).
 

Pathways for ABCB6 Antibody (NBP2-58327)

View related products by pathway.

PTMs for ABCB6 Antibody (NBP2-58327)

Learn more about PTMs related to ABCB6 Antibody (NBP2-58327).

Blogs on ABCB6

There are no specific blogs for ABCB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB6 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCB6