ABCB6 Antibody

Images

 
Western Blot: ABCB6 Antibody [NBP2-58327] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Orthogonal Strategies: Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ABCB6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD
Specificity
Specificity of human ABCB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABCB6 Antibody

  • ABC
  • ABC14
  • ABCB6
  • ATP-binding cassette, sub-family B (MDR/TAP), member 6
  • EC 3.6.3
  • EST45597
  • FLJ22414
  • LAN
  • MCOPCB7
  • Mitochondrial ABC transporter 3
  • mitochondrial
  • MTABC3
  • MTABC3ABC14
  • P-glycoprotein-related protein
  • PRP
  • Umat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, GS, PCR
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ABCB6 Antibody (NBP2-58327) (0)

There are no publications for ABCB6 Antibody (NBP2-58327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB6 Antibody (NBP2-58327) (0)

There are no reviews for ABCB6 Antibody (NBP2-58327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCB6 Antibody (NBP2-58327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABCB6 Products

Bioinformatics Tool for ABCB6 Antibody (NBP2-58327)

Discover related pathways, diseases and genes to ABCB6 Antibody (NBP2-58327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB6 Antibody (NBP2-58327)

Discover more about diseases related to ABCB6 Antibody (NBP2-58327).
 

Pathways for ABCB6 Antibody (NBP2-58327)

View related products by pathway.

PTMs for ABCB6 Antibody (NBP2-58327)

Learn more about PTMs related to ABCB6 Antibody (NBP2-58327).

Blogs on ABCB6

There are no specific blogs for ABCB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB6