Home » ABCB6 » ABCB6 Antibodies » ABCB6 Antibody

ABCB6 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Orthogonal Strategies: Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunocytochemistry/ Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ABCB6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCB6 Recombinant Protein Antigen (NBP2-58327PEP)
Publications
Read Publication using
NBP2-58327 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29879439).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABCB6 Antibody

  • ABC
  • ABC14
  • ABCB6
  • ATP-binding cassette, sub-family B (MDR/TAP), member 6
  • EC 3.6.3
  • EST45597
  • FLJ22414
  • LAN
  • MCOPCB7
  • Mitochondrial ABC transporter 3
  • mitochondrial
  • MTABC3
  • MTABC3ABC14
  • P-glycoprotein-related protein
  • PRP
  • Umat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PrPC Antibody
(SC57-05)
NBP2-67569
Flow Cytometry: PrPC Antibody (SC57-05) [NBP2-67569] - Analysis of SH-SY-5Y cells with PrPC antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug C2C12 whole cell lysate/extract 7.5% SDS-PAGE . GALNS antibody dilution: 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract7.5% SDS-PAGE GALNS antibody dilution: 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraformaldehyde-fixed HeLa, using GALNS antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ABCG2/CD338
Antibody (3G8)
NBP2-22124
ELISA: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Red: Control Antigen (100ng), Purple: Antigen (10ng), Green: Antigen (50ng), Blue: Antigen (100ng).
Flow Cytometry: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of HepG2 cells using ABCG2 mouse mAb (green) and negative control (purple).
Immunocytochemistry/Immunofluorescence: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of Hela cells using ABCG2 mouse mAb (green). DRAQ5 fluorescent DNA dye (blue). Actin filaments have been labeled with Alexa Fluor-555 phalloidin (red).
(6 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded human liver tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.
Immunohistochemistry-Frozen: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Mouse (B6) liver tissue. Fixed in ice-cold methanol for 10 minutes. Blocking in 10% serum and 1% BSA. Primary antibody at 5 ug/mL, overnight incubation. Secondary antibody at 2 ug/mL for 1.5 hour (Invitrogen A-11012). Mounting with Vector Vectashield with DAPI. Image from a verified customer review.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded mouse kidney tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MRP1 Antibody
(IU2H10)
NB400-156
Dual RNAscope ISH-IHC: MRP1 Antibody (IU2H10) [NB400-156] - Formalin-fixed paraffin-embedded tissue sections of human testis were probed for MRP1 mRNA (ACD RNAScope Probe, catalog # 435591; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse monoclonal (Novus Biologicals catalog # NB400-156) at 7ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to Leydig cells and seminiferous tubule cells.
Western Blot: MRP1 Antibody (IU2H10) [NB400-156] - Vector-transfected HEK293 cells 2: MRP1-transfected cells, prep1 3: MRP1-transfected cells, prep2 (the lower band is a degradation product.)
Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU2H10) [NB400-156] - The MRP-1 antibody was tested in HeLa cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
PrPSc Antibody
(3F4)
NBP2-81078
Immunocytochemistry/Immunofluorescence: PrPSc Antibody (3F4) [NBP2-81078] - Immunofluorescence staining of fixed U251 cells with [NBP2-81078]. Immunofluorescence analysis of paraformaldehyde fixed U251 cells on Shi-fix coverslips, permeabilized with 0.15% Triton and stained with the chimeric mouse IgG1 version of 3F4 [NBP2-81078] at 10 ug/ml for 1h followed by Alexa Fluor 488 secondary antibody (2 ug/ml), showing membrane staining. The nuclear stain is DAPI (blue). Panels show from left-right, top-bottom NBP2-81078, DAPI, merged channels and an isotype control. The isotype control was stained with an unknown specificity antibody followed by Alexa Fluor 488 secondary antibody.
Western Blot: PrPSc Antibody (3F4) [NBP2-81078] - Human brain cerebral cortex (A), cerebellum (B), and hippocampus (C) lysate samples (35ug protein in RIPA buffer) were resolved on a 10% SDS PAGE gel and blots probed with the chimeric mouse IgG1 version of PrPSc antibody (3F4) [NBP2-81078]. Cerebral cortex and hippocampus samples were probed using 0.001 ug/ml of NBP2-81078, and cerebellum samples with 0.003 ug/ml of NBP2-81078, before detection using an anti-mouse secondary antibody. A primary incubation of 1h was used and protein was detected by chemiluminescence. The predicted running size for unmodified major Prion protein is 27.7 kDa though this protein has several glycosylated forms, may be lipidated, sumoylated and post-translationally cleaved to produce the matrue form of the protein [Uniprot]. NBP2-81078 successfully detected major Prion protein in human brain cerebral cortex, cerebellum, and hippocampus lysates.
Species: Ha, Hu
Applications: ELISA, ICC/IF, IHC, IP, WB
MRP2 Antibody
(JA32-01)
NBP2-66958
Flow Cytometry: MRP2 Antibody (JA32-01) [NBP2-66958] - Analysis of A549 cells with MRP2 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: MRP2 Antibody (JA32-01) [NBP2-66958] - Staining MRP2 in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: MRP2 Antibody (JA32-01) [NBP2-66958] - Staining MRP2 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(13 Reviews)
(42 Publications)
Species: Hu
Applications: IHC, IP, WB
ASAH1 Antibody
NBP1-89296
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
(6 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
MSH3 Antibody
NBP2-19417
Western Blot: MSH3 Antibody [NBP2-19417] - H1299 whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with MSH3 antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MSH3 Antibody [NBP2-19417] - MSH3 antibody [C2C3], C-term detects MSH3 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:500.Blue: Fluoroshield with DAPI.Scale bar= 10 um.
Immunohistochemistry-Paraffin: MSH3 Antibody [NBP2-19417] - MSH3 antibody [C2C3], C-term detects MSH3 protein at nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human lung cancer.MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:600.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MDMX Antibody
NB100-556
Western Blot: MDMX Antibody [NB100-556] - Detection of human HdmX/MDM4 by western blot. Samples: Whole cell lysate (50 ug) from Jurkat, HEK293T, and HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-HdmX/MDM4 antibody NB100-556 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Immunoprecipitation: MDMX Antibody [NB100-556] - Detection of human HdmX/MDM4 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from Jurkat cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-HdmX/MDM4 antibody NB100-556 (lot NB100-556-4) used for IP at 6 ug per reaction. HdmX/MDM4 was also immunoprecipitated by a previous lot of this antibody (lot NB100-556-3) and another rabbit anti-HdmX/MDM4 antibody. For blotting immunoprecipitated HdmX/MDM4, NB100-556 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: MDMX Antibody [NB100-556] - Analysis using the Biotin conjugate of NB100-556. Detection of Jurkat (50, 15, and 5 ug). Antibody used at 1.0 ug/ml. Detection: Streptavidin-HRP and chemiluminescence with an exposure time of 30 seconds.
(32 Publications)
Species: Hu
Applications: IP, WB
TBC1D9 Antibody
NBP2-13415
Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Doppel Antibody
NBP2-31928
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining in human testis and endometrium tissues using anti-PRND antibody. Corresponding PRND RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining of human testis shows high expression.
Species: Hu
Applications: IHC, IHC-P
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Environmental novelty exacerbates stress hormones and Aβ pathology in an Alzheimer's model. Sci Rep (2017)
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(40 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
ABCA1 Antibody
NB400-105
Dual RNAscope ISH-IHC: ABCA1 Antibody [NB400-105] - Formalin-fixed paraffin-embedded tissue sections of human prostate cancer were probed for ABCA1 mRNA (ACD RNAScope Probe, catalog # 432291; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus Biologicals catalog # NB400-105) at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
Immunohistochemistry-Paraffin: ABCA1 Antibody [NB400-105] - Detection of ABCA1 in human prostate epithelium showing luminal and membrane staining.
Western Blot: ABCA1 Antibody [NB400-105] - Analysis of ABCA1 in total cell lysates of RAW264.9 cells treated with vehicle (-) or 9-cisretinoic acid and 22Rhydroxycholesterol (+). Samples used for this testing were 40 ug of total cell post-nuclear lysate from each group.
(7 Reviews)
(366 Publications)
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(683 Publications)
Species: Hu
Applications: BA
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
MARCKS like
protein Antibody
NBP2-38160
Immunohistochemistry-Paraffin: MARCKS like protein Antibody [NBP2-38160] - Analysis in human testis and skeletal muscle tissues using NBP2-38160 antibody. Corresponding MARCKSL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MARCKS like protein Antibody [NBP2-38160] - Staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MARCKS like protein Antibody [NBP2-38160] - Staining of human tonsil shows strong cytoplasmic and membranous positivity in non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GPR177/WLS Antibody
NBP2-57299
Western Blot: GPR177/WLS Antibody [NBP2-57299] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GPR177/WLS Antibody [NBP2-57299] - Staining of human placenta shows strong cytoplasmic positivity in cytotrophoblastic cells.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
ABCB6 Antibody
NBP2-58327
ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for ABCB6 Antibody (NBP2-58327)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ABCB6 Antibody (NBP2-58327) (0)

There are no reviews for ABCB6 Antibody (NBP2-58327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCB6 Antibody (NBP2-58327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ABCB6 Products

Bioinformatics Tool for ABCB6 Antibody (NBP2-58327)

Discover related pathways, diseases and genes to ABCB6 Antibody (NBP2-58327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB6 Antibody (NBP2-58327)

Discover more about diseases related to ABCB6 Antibody (NBP2-58327).
 

Pathways for ABCB6 Antibody (NBP2-58327)

View related products by pathway.

PTMs for ABCB6 Antibody (NBP2-58327)

Learn more about PTMs related to ABCB6 Antibody (NBP2-58327).

Blogs on ABCB6

There are no specific blogs for ABCB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB6 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCB6