ABC2 Antibody - BSA Free

Western Blot: ABC2 Antibody [NBP1-56876] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Western Blot: ABC2 Antibody [NBP1-56876] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: ABC2 Antibody [NBP1-56876] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: ABC2 Antibody [NBP1-56876] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Product Discontinued

ABC2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to C17ORF71 The peptide sequence was selected from the middle region of C17ORF71 (NP_060619). Peptide sequence HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMG8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 110 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ABC2 Antibody - BSA Free

• ABC2
• Amplified in breast cancer gene 2 protein
• chromosome 17 open reading frame 71
• FLJ10587
• Protein smg-8 homolog
• protein SMG8
• SMG8

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMG8
• Entrez:
  • 55181(Human)
• Uniprot:
  • Q8ND04(Human)