6 Phosphofructo 2 Kinase Antibody

Images

 
Western Blot: 6 Phosphofructo 2 Kinase Antibody [NBP1-87478] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: 6 Phosphofructo 2 Kinase Antibody [NBP1-87478] - Staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: 6 Phosphofructo 2 Kinase Antibody [NBP1-87478] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related 6 Phosphofructo 2 Kinase Primary Antibodies

Order Details


    • Catalog Number
      NBP1-87478
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

6 Phosphofructo 2 Kinase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PFKFB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 6 Phosphofructo 2 Kinase Antibody

  • 6 Phosphofructo 2 Kinase
  • 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase
  • 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • FLJ37326
  • inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • IPFK2
  • PFK/FBPase 3
  • PFK2
  • PFKFB3
  • Renal carcinoma antigen NY-REN-56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-32538
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478) (0)

There are no publications for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478) (0)

There are no reviews for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 6 Phosphofructo 2 Kinase Products

Bioinformatics Tool for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478)

Discover related pathways, diseases and genes to 6 Phosphofructo 2 Kinase Antibody (NBP1-87478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478)

Discover more about diseases related to 6 Phosphofructo 2 Kinase Antibody (NBP1-87478).
 

Pathways for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478)

View related products by pathway.

PTMs for 6 Phosphofructo 2 Kinase Antibody (NBP1-87478)

Learn more about PTMs related to 6 Phosphofructo 2 Kinase Antibody (NBP1-87478).

Blogs on 6 Phosphofructo 2 Kinase

There are no specific blogs for 6 Phosphofructo 2 Kinase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 6 Phosphofructo 2 Kinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKFB3
Entrez
Uniprot