5-HT6 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human 5-HT6 (NP_000862.1). Peptide sequence VANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HTR6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
48 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for 5-HT6 Antibody - BSA Free
Background
5-HT6, a Serotonin Receptor, appears to regulate cholinergic neurotransmission in the brain rather than the expected interaction as a modulator of dopaminergic transmission. This interaction predicts a possible role for 5-HT6 Receptor antagonists in the treatment of learning and memory disorders. The 5-HT6 Receptor is abundant in limbic areas, which participate in the control of mood and emotion. Some antidepressants and antipsychotics are potent 5-HT6 Receptor antagonists, making this gene valuable for the pharmaceutical industry. 5-HT6 may be involved in the pathogenesis of mood disorders, schizophrenia, in Alzheimer's disease. A splice variant that has a 289bp deletion in the transmembrane region IV and the third intracellular loop has been isolated. 5-HT6 Receptor has been reported primarily in striatum of the brain. Expression has also been seen in stomach, spinal cord, and the lymphoid tissues of rats, including peripheral blood lymphocytes, spleen, and thymus. ESTs have been isolated from brain libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for 5-HT6 Antibody (NBP3-10817) (0)
There are no publications for 5-HT6 Antibody (NBP3-10817).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 5-HT6 Antibody (NBP3-10817) (0)
There are no reviews for 5-HT6 Antibody (NBP3-10817).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 5-HT6 Antibody (NBP3-10817) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 5-HT6 Products
Research Areas for 5-HT6 Antibody (NBP3-10817)
Find related products by research area.
|
Blogs on 5-HT6