4EBP1 Antibody


Western Blot: 4EBP1 Antibody [NBP1-89368] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.
Western Blot: 4EBP1 Antibody [NBP1-89368] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-5

Product Details

Reactivity Hu, Mu, Rt, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

4EBP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Specificity of human, mouse, rat 4EBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
4EBP1 Lysate (NBP2-64630)
Control Peptide
4EBP1 Recombinant Protein Antigen (NBP1-89368PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for 4EBP1 Antibody

  • 4EBP1
  • 4E-BP1
  • eIF4E-binding protein 1
  • EIF4EBP1
  • eukaryotic translation initiation factor 4E binding protein 1,4EBP1,4E-BP1BP-1
  • eukaryotic translation initiation factor 4E-binding protein 1
  • PHAS-I
  • PHAS-IMGC4316
  • Phosphorylated heat- and acid-stable protein regulated by insulin 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for 4EBP1 Antibody (NBP1-89368) (0)

There are no publications for 4EBP1 Antibody (NBP1-89368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 4EBP1 Antibody (NBP1-89368) (0)

There are no reviews for 4EBP1 Antibody (NBP1-89368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 4EBP1 Antibody (NBP1-89368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional 4EBP1 Products

Bioinformatics Tool for 4EBP1 Antibody (NBP1-89368)

Discover related pathways, diseases and genes to 4EBP1 Antibody (NBP1-89368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 4EBP1 Antibody (NBP1-89368)

Discover more about diseases related to 4EBP1 Antibody (NBP1-89368).

Pathways for 4EBP1 Antibody (NBP1-89368)

View related products by pathway.

PTMs for 4EBP1 Antibody (NBP1-89368)

Learn more about PTMs related to 4EBP1 Antibody (NBP1-89368).

Blogs on 4EBP1

There are no specific blogs for 4EBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our 4EBP1 Antibody and receive a gift card or discount.


Gene Symbol EIF4EBP1