4-1BB Ligand/TNFSF9 Recombinant Protein Antigen

Images

 
There are currently no images for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

4-1BB Ligand/TNFSF9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 4-1BB Ligand/TNFSF9.

Source: E. coli

Amino Acid Sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFSF9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56103.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen

  • 41BB Ligand
  • 4-1BB Ligand
  • 4-1BBL
  • 4-1BB-L
  • CD137L
  • homolog of mouse 4-1BB-L
  • receptor 4-1BB ligand
  • TNFSF9
  • tumor necrosis factor (ligand) superfamily, member 9
  • tumor necrosis factor ligand superfamily member 9

Background

CD137 exists on the cell surface as a monomer with a molecular mass of 30 kDa and as a dimer of 55 kDa. Human and mouse CD137 share 60% amino acid identity. CD137 (4-1BB), a member of the tumor necrosis factor receptor superfamily, is a type I transmembrane glycoprotein expressed on the cell surface of activated splenic T cells and thymocytes. The functions of CD137 in T lymphocytes include regulating activation, proliferation and apoptosis. CD137 and CD28 are costimulatory molecules of T cell activation. Costimulatory molecules are important in initiating anti-tumor immune responses. CD137 plays an important role in regulating T-cell-dependent immune responses. Expression of CD137 correlates negatively with lymphocyte proliferation and positively with the degree of activation-induced cell death caused by mitogen over stimulation. In monocytes, CD137 induces activation, promotes adherence and prolongs survival.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF838
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
485-MI
Species: Mu
Applications: BA
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
DCDL40
Species: Hu
Applications: ELISA
AF3388
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
MAB2738
Species: Hu
Applications: Flow
AF1028
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
DY417
Species: Mu
Applications: ELISA

Publications for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP) (0)

There are no publications for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP) (0)

There are no reviews for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 4-1BB Ligand/TNFSF9 Products

Research Areas for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP)

Find related products by research area.

Blogs on 4-1BB Ligand/TNFSF9

There are no specific blogs for 4-1BB Ligand/TNFSF9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF9