15-Lipoxygenase 1 Antibody

Images

 
Western Blot: 15-Lipoxygenase 1 Antibody [H00000246-D01P] - Analysis of ALOX15 expression in mouse spleen.
Western Blot: 15-Lipoxygenase 1 Antibody [H00000246-D01P] - Analysis of ALOX15 expression in transfected 293T cell line by ALOX15 polyclonal antibody.Lane 1: ALOX15 transfected lysate(74.80 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

15-Lipoxygenase 1 Antibody Summary

Immunogen
ALOX15 (AAH29032.1, 1 a.a. - 662 a.a.) full-length human protein. MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Specificity
ALOX15 - arachidonate 15-lipoxygenase,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALOX15
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000246-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 15-Lipoxygenase 1 Antibody

  • 15-lipooxygenase-1
  • 15-LOX-1
  • 15LOX-1
  • arachidonate 15-lipoxygenase
  • Arachidonate omega-6 lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.33
  • LOG15,15-LOX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000246-D01P
Species: Hu, Mu
Applications: WB

Publications for 15-Lipoxygenase 1 Antibody (H00000246-D01P)(1)

Reviews for 15-Lipoxygenase 1 Antibody (H00000246-D01P) (0)

There are no reviews for 15-Lipoxygenase 1 Antibody (H00000246-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 15-Lipoxygenase 1 Antibody (H00000246-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 15-Lipoxygenase 1 Products

Bioinformatics Tool for 15-Lipoxygenase 1 Antibody (H00000246-D01P)

Discover related pathways, diseases and genes to 15-Lipoxygenase 1 Antibody (H00000246-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 15-Lipoxygenase 1 Antibody (H00000246-D01P)

Discover more about diseases related to 15-Lipoxygenase 1 Antibody (H00000246-D01P).
 

Pathways for 15-Lipoxygenase 1 Antibody (H00000246-D01P)

View related products by pathway.

PTMs for 15-Lipoxygenase 1 Antibody (H00000246-D01P)

Learn more about PTMs related to 15-Lipoxygenase 1 Antibody (H00000246-D01P).
 

Research Areas for 15-Lipoxygenase 1 Antibody (H00000246-D01P)

Find related products by research area.

Blogs on 15-Lipoxygenase 1

There are no specific blogs for 15-Lipoxygenase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 15-Lipoxygenase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX15
Entrez
Uniprot