14-3-3 eta Antibody (1C2)

Images

 
There are currently no images for 14-3-3 eta Antibody (H00007533-M07).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

14-3-3 eta Antibody (1C2) Summary

Immunogen
YWHAH (AAH03047, 71 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
YWHAH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 14-3-3 eta Antibody (1C2)

  • 1433 eta
  • 14-3-3 eta
  • 14-3-3 protein eta
  • Protein AS1
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, etapolypeptide
  • YWHA1
  • YWHA114-3-3 eta
  • YWHAH

Background

Members of the 14-3-3 family of proteins are highly conserved proteins, localized in neurons, and are axonally transported to the nerve terminals. They are also present, at lower levels, in various other eukaryotic tissues. 14-3-3 proteins appear to play important roles in a variety of signal transduction pathways, including those involved in cell cycle regulation and cell survival. Because 14-3-3 proteins bind to specific phosphoserine-containing sequences they are likely to have an important role in signaling pathways mediated by serine/threonine protein kinases. Evidence indicates 14-3-3 is required for Raf 1 kinase activity and phosphorylation among many other functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00001815-R02
Species: Hu
H00001646-M03
Species: Hu
Applications: WB, ELISA
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for 14-3-3 eta Antibody (H00007533-M07) (0)

There are no publications for 14-3-3 eta Antibody (H00007533-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 eta Antibody (H00007533-M07) (0)

There are no reviews for 14-3-3 eta Antibody (H00007533-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 eta Antibody (H00007533-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 eta Products

Bioinformatics Tool for 14-3-3 eta Antibody (H00007533-M07)

Discover related pathways, diseases and genes to 14-3-3 eta Antibody (H00007533-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 eta Antibody (H00007533-M07)

Discover more about diseases related to 14-3-3 eta Antibody (H00007533-M07).
 

Pathways for 14-3-3 eta Antibody (H00007533-M07)

View related products by pathway.

PTMs for 14-3-3 eta Antibody (H00007533-M07)

Learn more about PTMs related to 14-3-3 eta Antibody (H00007533-M07).
 

Research Areas for 14-3-3 eta Antibody (H00007533-M07)

Find related products by research area.

Blogs on 14-3-3 eta

There are no specific blogs for 14-3-3 eta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 14-3-3 eta Antibody (1C2) and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAH
Entrez
Uniprot