11 beta-HSD1 Antibody

Images

 
Western Blot: 11 beta-HSD1 Antibody [H00003290-D01P] - Analysis of HSD11B1 expression in human liver.
Western Blot: 11 beta-HSD1 Antibody [H00003290-D01P] - Analysis of HSD11B1 expression in transfected 293T cell line by HSD11B1 polyclonal antibody.Lane 1: HSD11B1 transfected lysate(32.40 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

11 beta-HSD1 Antibody Summary

Immunogen
HSD11B1 (NP_005516.1, 1 a.a. - 292 a.a.) full-length human protein. MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Specificity
HSD11B1 - hydroxysteroid (11-beta) dehydrogenase 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD11B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 11 beta-HSD1 Antibody

  • 11 betaHSD1
  • 11 beta-HSD1
  • 11-beta-hydroxysteroid dehydrogenase 1
  • EC 1.1.1
  • EC 1.1.1.146
  • HDL
  • HSD11B1
  • HSD11HSD11B
  • HSD11LMGC13539
  • hydroxysteroid (11-beta) dehydrogenase 1
  • member 1
  • SDR26C1

Background

The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8630
Species: Hu
Applications: WB, IHC
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
7570-GH
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
H00003290-D01P
Species: Hu
Applications: WB

Publications for 11 beta-HSD1 Antibody (H00003290-D01P) (0)

There are no publications for 11 beta-HSD1 Antibody (H00003290-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 11 beta-HSD1 Antibody (H00003290-D01P) (0)

There are no reviews for 11 beta-HSD1 Antibody (H00003290-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 11 beta-HSD1 Antibody (H00003290-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 11 beta-HSD1 Products

Bioinformatics Tool for 11 beta-HSD1 Antibody (H00003290-D01P)

Discover related pathways, diseases and genes to 11 beta-HSD1 Antibody (H00003290-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 11 beta-HSD1 Antibody (H00003290-D01P)

Discover more about diseases related to 11 beta-HSD1 Antibody (H00003290-D01P).
 

Pathways for 11 beta-HSD1 Antibody (H00003290-D01P)

View related products by pathway.

PTMs for 11 beta-HSD1 Antibody (H00003290-D01P)

Learn more about PTMs related to 11 beta-HSD1 Antibody (H00003290-D01P).
 

Research Areas for 11 beta-HSD1 Antibody (H00003290-D01P)

Find related products by research area.

Blogs on 11 beta-HSD1

There are no specific blogs for 11 beta-HSD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 11 beta-HSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD11B1
Entrez
Uniprot