Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!
Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research
CARD14 Antibody Summary
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKERDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARD14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for CARD14 Antibody
bcl10-interacting maguk protein 2
BIMP2
CARD-containing MAGUK protein 2
card-maguk protein 2
Carma 2
CARMA2CARD-containing MAGUK 2 protein
caspase recruitment domain family, member 14
caspase recruitment domain-containing protein 14
Background
The protein encoded by the CARD14 gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class ofproteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions ofthe plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying acharacteristic caspase-associated recruitment domain (CARD). This protein shares a similar domain structure withCARD11 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein knownto function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this proteinactivated NF-kappaB and induced the phosphorylation of BCL10. Two alternatively spliced variants of this gene encodingdistinct isoforms have been reported. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
CARD14: The First Gene to be Linked to Psoriasis Psoriasis is an autoimmune disease affects 3% of the United Kingdom's population and 7.5 million people in the United States are affected. This disease causes plaque formation on the skin due to an increased rate of skin cell growth. Psoriasis is trig... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CARD14 Antibody and receive a gift card or discount.