Zyxin Recombinant Protein Antigen

Images

 
There are currently no images for Zyxin Recombinant Protein Antigen (NBP2-54751PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Zyxin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZYX.

Source: E. coli

Amino Acid Sequence: PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZYX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54751.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Zyxin Recombinant Protein Antigen

  • CTCL tumor antigen se14-3
  • CTCL-associated antigen se14-3
  • cutaneous T-cell lymphoma associated antigen se14-3
  • Cutaneous T-cell lymphoma-associated antigen se14-3
  • KIAA1125
  • MGC31836
  • predicted protein of HQ2893
  • PRKCBP1
  • PRO2893
  • protein kinase C-binding protein 1
  • Rack7
  • RACK7protein kinase C binding protein 1
  • zinc finger MYND domain containing protein 8
  • Zinc finger MYND domain-containing protein 8
  • zinc finger, MYND-type containing 8
  • Zyx
  • Zyxin 2
  • Zyxin

Background

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-89549
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4467
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP1-80833
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-33667
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-47384
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-16424
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1444
Species: Mu
Applications: IHC, WB

Publications for Zyxin Recombinant Protein Antigen (NBP2-54751PEP) (0)

There are no publications for Zyxin Recombinant Protein Antigen (NBP2-54751PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zyxin Recombinant Protein Antigen (NBP2-54751PEP) (0)

There are no reviews for Zyxin Recombinant Protein Antigen (NBP2-54751PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Zyxin Recombinant Protein Antigen (NBP2-54751PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Zyxin Products

Array NBP2-54751PEP

Research Areas for Zyxin Recombinant Protein Antigen (NBP2-54751PEP)

Find related products by research area.

Blogs on Zyxin

There are no specific blogs for Zyxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Zyxin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZYX