ZSCAN4 Antibody (2C7)

Images

 
Sandwich ELISA: ZSCAN4 Antibody (2C7) [H00201516-M04] - Detection limit for recombinant GST tagged ZSCAN4 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZSCAN4 Antibody (2C7) Summary

Immunogen
ZSCAN4 (NP_689890.1, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCND
Specificity
ZSCAN4 - zinc finger and SCAN domain containing 4 (2C7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZSCAN4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZSCAN4 Antibody (2C7)

  • FLJ35105
  • MGC126787
  • zinc finger and SCAN domain containing 4
  • Zinc finger protein 494MGC126789
  • ZNF494zinc finger and SCAN domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-84863
Species: Hu
Applications: WB, IHC, IHC-P
AF2566
Species: Mu
Applications: WB, IHC
NBL1-10171
Species: Hu
NBP2-27098
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB110-78644
Species: Hu, Rt, Po, Pm, Bv, Gt, Pm, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
H00003292-M03
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF4509
Species: Hu
Applications: WB, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24951
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00201516-M04
Species: Hu
Applications: ELISA, S-ELISA

Publications for ZSCAN4 Antibody (H00201516-M04) (0)

There are no publications for ZSCAN4 Antibody (H00201516-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZSCAN4 Antibody (H00201516-M04) (0)

There are no reviews for ZSCAN4 Antibody (H00201516-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZSCAN4 Antibody (H00201516-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZSCAN4 Products

Bioinformatics Tool for ZSCAN4 Antibody (H00201516-M04)

Discover related pathways, diseases and genes to ZSCAN4 Antibody (H00201516-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZSCAN4 Antibody (H00201516-M04)

Discover more about diseases related to ZSCAN4 Antibody (H00201516-M04).
 

Pathways for ZSCAN4 Antibody (H00201516-M04)

View related products by pathway.

Blogs on ZSCAN4

There are no specific blogs for ZSCAN4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZSCAN4 Antibody (2C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN4
Entrez
Uniprot