Novus Biologicals products are now on bio-techne.com

ZSCAN1 Antibody

Images

 
Western Blot: ZSCAN1 Antibody [NBP1-80437] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

ZSCAN1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human ZSCAN1. Peptide sequence PECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZSCAN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ZSCAN1 Antibody

  • FLJ33779
  • MGC104472
  • MZF-1
  • zinc finger and SCAN domain containing 1
  • zinc finger and SCAN domain-containing protein 1
  • zinc finger with SCAN domain 1
  • ZNF915

Background

"ZSCAN1 may be involved in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-23849
Species: Hu
Applications: Flow, ICC/IF, IHC-P
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF3444
Species: Hu
Applications: IHC, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-80437
Species: Hu
Applications: WB

Publications for ZSCAN1 Antibody (NBP1-80437) (0)

There are no publications for ZSCAN1 Antibody (NBP1-80437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZSCAN1 Antibody (NBP1-80437) (0)

There are no reviews for ZSCAN1 Antibody (NBP1-80437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZSCAN1 Antibody (NBP1-80437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZSCAN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN1
Uniprot