ZRANB2 Antibody

Images

 
Immunohistochemistry-Paraffin: ZRANB2 Antibody [NBP2-32378] - Staining of human kidney shows strong nuclear positivity in cells in tubules, cells in glomeruli were moderately stained.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZRANB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZRANB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZRANB2 Protein (NBP2-32378PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZRANB2 Antibody

  • Oocyte-specific maternal effect factor
  • zygote arrest 1
  • zygote arrest protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
H00008227-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
AF5540
Species: Mu
Applications: WB
640-A3
Species: Mu
NBP2-58847
Species: Hu
Applications: WB, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for ZRANB2 Antibody (NBP2-32378) (0)

There are no publications for ZRANB2 Antibody (NBP2-32378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZRANB2 Antibody (NBP2-32378) (0)

There are no reviews for ZRANB2 Antibody (NBP2-32378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZRANB2 Antibody (NBP2-32378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZRANB2 Products

Bioinformatics Tool for ZRANB2 Antibody (NBP2-32378)

Discover related pathways, diseases and genes to ZRANB2 Antibody (NBP2-32378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZRANB2 Antibody (NBP2-32378)

Discover more about diseases related to ZRANB2 Antibody (NBP2-32378).
 

Pathways for ZRANB2 Antibody (NBP2-32378)

View related products by pathway.

PTMs for ZRANB2 Antibody (NBP2-32378)

Learn more about PTMs related to ZRANB2 Antibody (NBP2-32378).

Blogs on ZRANB2

There are no specific blogs for ZRANB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZRANB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZRANB2