XE7 Antibody (2G8)

Images

 
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - SFRS17A monoclonal antibody (M02), clone 2G8 Analysis of SFRS17A expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml.
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - Analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.Lane 1: SFRS17A transfected lysate(51.5 KDa).Lane 2: ...read more
Sandwich ELISA: XE7 Antibody (2G8) [H00008227-M02] - Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

XE7 Antibody (2G8) Summary

Immunogen
SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Specificity
RP13-297E16.1 - DNA segment on chromosome X and Y (unique) 155 expressed sequence, isoform 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKAP17A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XE7 Antibody (2G8)

  • A kinase (PRKA) anchor protein 17A
  • AKAP-17A
  • A-kinase anchor protein 17A
  • B-lymphocyte antigen
  • B-lymphocyte surface antigen
  • CCDC133
  • CXYorf3
  • DXYS155EPRKA17A
  • MGC39904
  • Protein kinase A-anchoring protein 17A
  • Protein XE7
  • pseudoautosomal gene XE7
  • SFRS17AMGC125366
  • Splicing factor, arginine/serine-rich 17AFLJ98315,721PMGC125365
  • XE7chromosome X and Y open reading frame 3
  • XE7Y

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009406-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3968
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
MAB6130
Species: Mu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
AF3700
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-28875
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84333
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43801
Species: Hu, Mu, Rt
Applications: WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04502
Species: Hu
Applications: ICC/IF, WB
NBP2-34005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
MAB6917
Species: Mu
Applications: CyTOF-ready, Flow, IHC
H00008227-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for XE7 Antibody (H00008227-M02) (0)

There are no publications for XE7 Antibody (H00008227-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XE7 Antibody (H00008227-M02) (0)

There are no reviews for XE7 Antibody (H00008227-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XE7 Antibody (H00008227-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XE7 Products

Array H00008227-M02

Bioinformatics Tool for XE7 Antibody (H00008227-M02)

Discover related pathways, diseases and genes to XE7 Antibody (H00008227-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for XE7 Antibody (H00008227-M02)

View related products by pathway.

PTMs for XE7 Antibody (H00008227-M02)

Learn more about PTMs related to XE7 Antibody (H00008227-M02).

Blogs on XE7

There are no specific blogs for XE7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XE7 Antibody (2G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP17A
Entrez
OMIM
Uniprot