Home » XE7 » XE7 Antibodies » XE7 Antibody (2G8)

XE7 Antibody (2G8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - SFRS17A monoclonal antibody (M02), clone 2G8 Analysis of SFRS17A expression in Hela S3 NE.
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - SFRS17A monoclonal antibody (M02), clone 2G8 Analysis of SFRS17A expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml.
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - Analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.Lane 1: SFRS17A transfected lysate(51.5 KDa).Lane 2: ...read more
Sandwich ELISA: XE7 Antibody (2G8) [H00008227-M02] - Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

XE7 Antibody (2G8) Summary

Immunogen
SFRS17A (NP_005079, 53 a.a. - 156 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Specificity
RP13-297E16.1 - DNA segment on chromosome X and Y (unique) 155 expressed sequence, isoform 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKAP17A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XE7 Antibody (2G8)

  • A kinase (PRKA) anchor protein 17A
  • AKAP-17A
  • A-kinase anchor protein 17A
  • B-lymphocyte antigen
  • B-lymphocyte surface antigen
  • CCDC133
  • CXYorf3
  • DXYS155EPRKA17A
  • MGC39904
  • Protein kinase A-anchoring protein 17A
  • Protein XE7
  • pseudoautosomal gene XE7
  • SFRS17AMGC125366
  • Splicing factor, arginine/serine-rich 17AFLJ98315,721PMGC125365
  • XE7chromosome X and Y open reading frame 3
  • XE7Y

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZRANB2 Antibody
(2A11)
H00009406-M02
Western Blot: ZRANB2 Antibody (2A11) [H00009406-M02] - ZNF265 monoclonal antibody (M02), clone 2A11 Analysis of ZNF265 expression in Jurkat.
Western Blot: ZRANB2 Antibody (2A11) [H00009406-M02] - ZNF265 monoclonal antibody (M02), clone 2A11. Analysis of ZNF265 expression in PC-12.
Western Blot: ZRANB2 Antibody (2A11) [H00009406-M02] - ZNF265 monoclonal antibody (M02), clone 2A11. Analysis of ZNF265 expression in NIH/3T3.
Species: Hu, Mu, Rt
Applications: WB, ELISA
SF2 Antibody
NBP2-20324
Western Blot: SF2 Antibody [NBP2-20324] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SF2 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SF2 Antibody [NBP2-20324] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using SF2 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: SF2 Antibody [NBP2-20324] - Paraffin-embedded mouse duodenum. SF2 antibody dilution: 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CD99 Antibody
(JF0991)
NBP2-67019
Western Blot: CD99 Antibody (JF0991) [NBP2-67019] - Analysis of CD99 on THP-1 cells lysates using anti-CD99 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: CD99 Antibody (JF0991) [NBP2-67019] - Staining CD99 in PANC-1 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CD99 Antibody (JF0991) [NBP2-67019] - Analysis of paraffin-embedded human uterus tissue using anti-CD99 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
GM-CSF R alpha
Antibody (698423) [Un ...
MAB6130
GM‑CSF R alpha was detected in immersion fixed J774A.1 mouse reticulum cell sarcoma macrophage cell line using Rat Anti-Mouse GM‑CSF R alpha Mono­clonal Antibody (Catalog # MAB6130) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red, upper panel; Catalog # NL013) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Rat Anti-Mouse GM‑CSF R alpha Monoclonal Antibody (Catalog # MAB6130, filled histo­gram) or isotype control antibody (Catalog # MAB006, open histo­gram), followed by Allophy­cocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
Recombinant Mouse GM‑CSF (Catalog # 415-ML) stimulates proliferation in the DA3 mouse myeloma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Mouse GM‑CSF (0.1 ng/mL) is neutralized (green line) by increasing concen­trations of Rat Anti-Mouse GM‑CSF R alpha Monoclonal Anti­body (Catalog # MAB6130). The ND50 is typically0.02-0.12 µg/mL.
(3 Publications)
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
Proteasome 19S S5A
Antibody
NBP1-90821
Immunocytochemistry/Immunofluorescence: Proteasome 19S S5A Antibody [NBP1-90821] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining in human testis and pancreas tissues using anti-PSMD4 antibody. Corresponding PSMD4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, IP, Neut
Cubilin Antibody
[Unconjugated]
AF3700
Western blot shows lysates of human, mouse, and rat kidney tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Cubilin at approximately 500 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for Cubilin at approximately 500 kDa (as indicated) using 10 µg/mL of Sheep Anti-Human Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
CD20 Antibody
(AISB12)
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow
Cytokeratin 20
Antibody
NBP1-85599
Western Blot: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine and liver tissues. Corresponding KRT20 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human liver shows no positivity in hepatocytes as expected
Species: Hu
Applications: WB, IHC, IHC-P
PEG10 Antibody
NBP2-13749
Immunocytochemistry/Immunofluorescence: PEG10 Antibody [NBP2-13749] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Analysis in human placenta and prostate tissues using Anti-PEG10 antibody. Corresponding PEG10 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Connexin 30.1/GJB5
Antibody
NBP1-84333
Western Blot: Connexin 30.1/GJB5 Antibody [NBP1-84333] - Analysis in control (vector only transfected HEK293T lysate) and GJB5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody [NBP1-84333] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
ASMT Antibody
NBP2-43801
Western Blot: ASMT Antibody [NBP2-43801] - Analysis of Whole cell extracts (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with ASMT antibody at a dilution of 1:1000.
Species: Hu
Applications: WB
SC35 Antibody
(SC-35)
NB100-1774
Western Blot: SC35 Antibody (SC-35) [NB100-1774] - SC-35 recombinant protein (3 ug) was separated on SDS-PAGE and probed with Mouse Anti-Splicing Factor SC-35 Clone: SC-35. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and a chemiluminescent substrate. Lanes 1. Antibody dilution 1:100; 2. Antibody dilution 1:250; 3. Antibody dilution 1:500; 4. Antibody dilution 1:1,000
Immunocytochemistry/Immunofluorescence: SC35 Antibody (SC-35) [NB100-1774] - HS-68 cells were fixed and permeabilized with 4% Paraformaldehyde and 0.5% Triton X-100. Fixed cells were stained with Mouse Anti-Splicing Factor Clone: SC-35 diluted to 1:2,000. The antibody was developed using Goat Anti-Mouse IgG, FITC-conjugate.
(5 Publications)
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
ARSF Antibody
NBP1-86191
Western Blot: ARSF Antibody [NBP1-86191] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ARSF Antibody [NBP1-86191] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ARSF Antibody [NBP1-86191] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF
SFMBT2 Antibody
NBP2-34005
Immunocytochemistry/Immunofluorescence: SFMBT2 Antibody [NBP2-34005] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles & aggresome.
Immunohistochemistry-Paraffin: SFMBT2 Antibody [NBP2-34005] - Staining of human appendix shows cytoplasmic positivity in lymphoid tissue.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SFRS3 Antibody
(2D2)
H00006428-M08
Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/Immunofluorescence: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of monoclonal antibody to SFRS3 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in HeLa (Cat # L013V1).
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
PLET-1 Antibody
(700738) [Unconjugate
MAB6917
PLET‑1 was detected in immersion fixed frozen sections of adult mouse kidney using Rat Anti-Mouse PLET‑1 Monoclonal Antibody (Catalog # MAB6917) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to medulla collecting ducts. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Mouse thymocytes were stained with Rat Anti-Mouse PLET‑1 Monoclonal Antibody (Catalog # MAB6917, filled histogram) or isotype control antibody (Catalog # MAB005, open histogram), followed by Allophycocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
Species: Mu
Applications: Flow, IHC, CyTOF-ready
XE7 Antibody (2G8)
H00008227-M02
XE7 Antibody (2G8)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for XE7 Antibody (H00008227-M02) (0)

There are no publications for XE7 Antibody (H00008227-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XE7 Antibody (H00008227-M02) (0)

There are no reviews for XE7 Antibody (H00008227-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XE7 Antibody (H00008227-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for XE7 Antibody (H00008227-M02)

Discover related pathways, diseases and genes to XE7 Antibody (H00008227-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for XE7 Antibody (H00008227-M02)

View related products by pathway.

PTMs for XE7 Antibody (H00008227-M02)

Learn more about PTMs related to XE7 Antibody (H00008227-M02).

Blogs on XE7

There are no specific blogs for XE7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XE7 Antibody (2G8) and receive a gift card or discount.


Bioinformatics

Gene Symbol AKAP17A
Entrez
OMIM
Uniprot