Home » XE7 » XE7 Antibodies » XE7 Antibody (2G8)

XE7 Antibody (2G8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - SFRS17A monoclonal antibody (M02), clone 2G8 Analysis of SFRS17A expression in Hela S3 NE.
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - SFRS17A monoclonal antibody (M02), clone 2G8 Analysis of SFRS17A expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml.
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - Analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.Lane 1: SFRS17A transfected lysate(51.5 KDa).Lane 2: ...read more
Sandwich ELISA: XE7 Antibody (2G8) [H00008227-M02] - Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

XE7 Antibody (2G8) Summary

Immunogen
SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Specificity
RP13-297E16.1 - DNA segment on chromosome X and Y (unique) 155 expressed sequence, isoform 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKAP17A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XE7 Antibody (2G8)

  • A kinase (PRKA) anchor protein 17A
  • AKAP-17A
  • A-kinase anchor protein 17A
  • B-lymphocyte antigen
  • B-lymphocyte surface antigen
  • CCDC133
  • CXYorf3
  • DXYS155EPRKA17A
  • MGC39904
  • Protein kinase A-anchoring protein 17A
  • Protein XE7
  • pseudoautosomal gene XE7
  • SFRS17AMGC125366
  • Splicing factor, arginine/serine-rich 17AFLJ98315,721PMGC125365
  • XE7chromosome X and Y open reading frame 3
  • XE7Y

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZRANB2 Antibody
(2A11)
H00009406-M02
Sandwich ELISA: ZRANB2 Antibody (2A11) [H00009406-M02] - Detection limit for recombinant GST tagged ZNF265 is approximately 0.3ng/ml as a capture antibody.
Western Blot: ZRANB2 Antibody (2A11) [H00009406-M02] - ZNF265 monoclonal antibody (M02), clone 2A11. Analysis of ZNF265 expression in PC-12.
Western Blot: ZRANB2 Antibody (2A11) [H00009406-M02] - ZNF265 monoclonal antibody (M02), clone 2A11. Analysis of ZNF265 expression in NIH/3T3.
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
SF2 Antibody
NBP2-20324
Western Blot: SF2 Antibody [NBP2-20324] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with SF2 antibody diluted at 1:5000.
Western Blot: SF2 Antibody [NBP2-20324] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: SF2 Antibody [NBP2-20324] - Antibody detects SFRS1 protein at nucleus on BT483 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded BT483 xenograft. Antibody dilution: 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD99 Antibody
[Unconjugated]
AF3968
Human whole blood CD3+ lymphocytes were stained with Goat Anti-Human CD99 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3968, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
Western blot shows lysates of NCI‑H460 human large cell lung carcinoma cell line, U251-MG human malignant glioblastoma cell line, amd SK‑Mel‑28 human malignant melanoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human CD99 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3968) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for CD99 at approximately 32 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MOLT‑4 human acute lymphoblastic leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for CD99 at approximately 37 kDa (as indicated) using 20 µg/mL of Goat Anti-Human CD99 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3968) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
GM-CSFR alpha
Antibody (698423) [Un ...
MAB6130
GM‑CSF R alpha was detected in immersion fixed J774A.1 mouse reticulum cell sarcoma macrophage cell line using Rat Anti-Mouse GM‑CSF R alpha Mono­clonal Antibody (Catalog # MAB6130) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red, upper panel; Catalog # NL013) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Rat Anti-Mouse GM‑CSF R alpha Monoclonal Antibody (Catalog # MAB6130, filled histo­gram) or isotype control antibody (Catalog # MAB006, open histo­gram), followed by Allophy­cocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
Recombinant Mouse GM‑CSF (Catalog # 415-ML) stimulates proliferation in the DA3 mouse myeloma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Mouse GM‑CSF (0.1 ng/mL) is neutralized (green line) by increasing concen­trations of Rat Anti-Mouse GM‑CSF R alpha Monoclonal Anti­body (Catalog # MAB6130). The ND50 is typically0.02-0.12 µg/mL.
(5 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, Neut
S5a/Angiocidin
Antibody
NBP2-37888
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-PSMD4 antibody NBP2-37888 (A) shows similar protein distribution across tissues to independent antibody NBP1-90821 (B).
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC, IP, Neut, WB
Cubilin Antibody
[Unconjugated]
AF3700
Cubilin was detected in immersion fixed paraffin-embedded sections of human kidney tissue using Sheep Anti-Human/Mouse/Rat Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) at 1 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep IgG VisUCyte™ HRP Polymer Antibody (brown; Catalog # VC006) and counterstained with hematoxylin (blue). Specific staining was localized to convoluted tubules. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Western blot shows lysates of human, mouse, and rat kidney tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Cubilin at approximately 500 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for Cubilin at approximately 500 kDa (as indicated) using 10 µg/mL of Sheep Anti-Human Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of CRC cells with Cytokeratin 20 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded human colon cancer tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
PEG10 Antibody
(1B1C4)
NBP1-28875
Western Blot: PEG10 Antibody (1B1C4) [NBP1-28875] - Analysis using PEG10 monoclonal antibody against truncated Trx-PEG10 recombinant protein(1),truncated GST-PEG10(aa1-120) recombinant protein(2) and full-length PEG10(aa1-325)-hIgGFc transfected CHO-K1 cell lysate(3). .
Immunocytochemistry/Immunofluorescence: PEG10 Antibody (1B1C4) [NBP1-28875] - Analysis of methanol-fixed HepG2 cells using anti-PEG10 monoclonal antioby (green), showing cytoplasmic localization. Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: PEG10 Antibody (1B1C4) [NBP1-28875] - Immunohistochemical analysis of paraffin-embedded human Placenta tissues using PEG10 mouse mAb
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Connexin 30.1/GJB5
Antibody
NBP1-84333
Western Blot: Connexin 30.1/GJB5 Antibody [NBP1-84333] - Analysis in control (vector only transfected HEK293T lysate) and GJB5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody [NBP1-84333] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ASMT Antibody
NBP2-43801
Western Blot: ASMT Antibody [NBP2-43801] - Various tissue extracts (50 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ASMT antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: ASMT Antibody [NBP2-43801] - Analysis of Whole cell extracts (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with ASMT antibody at a dilution of 1:1000.
Species: Hu, Mu, Rt
Applications: WB
SC35 Antibody
NBP2-47290
Western Blot: SC35 Antibody [NBP2-47290] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ARSF Antibody
NBP3-04502
Immunocytochemistry/Immunofluorescence: ARSF Antibody [NBP3-04502] - Analysis of U2OS cells using ARSF antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu
Applications: ICC/IF, WB
SFMBT2 Antibody
NBP2-34005
Immunocytochemistry/Immunofluorescence: SFMBT2 Antibody [NBP2-34005] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles & aggresome.
Immunohistochemistry-Paraffin: SFMBT2 Antibody [NBP2-34005] - Staining of human appendix shows cytoplasmic positivity in lymphoid tissue.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SFRS3 Antibody
(2D2)
H00006428-M08
ELISA: SFRS3 Antibody (2D2) [H00006428-M08] - Detection limit for recombinant GST tagged SFRS3 is approximately 0.1ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of monoclonal antibody to SFRS3 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in HeLa (Cat # L013V1).
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
PLET-1 Antibody
(700738) [Unconjugate
MAB6917
PLET‑1 was detected in immersion fixed frozen sections of adult mouse kidney using Rat Anti-Mouse PLET‑1 Monoclonal Antibody (Catalog # MAB6917) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to medulla collecting ducts. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Mouse thymocytes were stained with Rat Anti-Mouse PLET‑1 Monoclonal Antibody (Catalog # MAB6917, filled histogram) or isotype control antibody (Catalog # MAB005, open histogram), followed by Allophycocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
Species: Mu
Applications: CyTOF-ready, Flow, IHC
XE7 Antibody (2G8)
H00008227-M02
XE7 Antibody (2G8)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for XE7 Antibody (H00008227-M02) (0)

There are no publications for XE7 Antibody (H00008227-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XE7 Antibody (H00008227-M02) (0)

There are no reviews for XE7 Antibody (H00008227-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XE7 Antibody (H00008227-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XE7 Products

Array H00008227-M02

Bioinformatics Tool for XE7 Antibody (H00008227-M02)

Discover related pathways, diseases and genes to XE7 Antibody (H00008227-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for XE7 Antibody (H00008227-M02)

View related products by pathway.

PTMs for XE7 Antibody (H00008227-M02)

Learn more about PTMs related to XE7 Antibody (H00008227-M02).

Blogs on XE7

There are no specific blogs for XE7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XE7 Antibody (2G8) and receive a gift card or discount.


Bioinformatics

Gene Symbol AKAP17A
Entrez
OMIM
Uniprot