ZNRF1 Antibody - Azide and BSA Free

Western Blot: ZNRF1 Antibody [H00084937-B01P] - Analysis of ZNRF1 expression in transfected 293T cell line by ZNRF1 polyclonal antibody. Lane1:ZNRF1 transfected lysate(24.97 KDa). Lane2:Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNRF1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNRF1 Antibody - Azide and BSA Free (H00084937-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNRF1 (NP_115644.1, 1 a.a. - 227 a.a.) full-length human protein. MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
• Specificity: ZNRF1 - zinc and ring finger 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZNRF1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate for western blot and recombinant protein with GST tag for ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNRF1 Antibody - Azide and BSA Free

• DKFZp434E229
• EC 6.3.2
• EC 6.3.2.-
• FLJ14846
• MGC15430
• nerve injury gene 283
• Nerve injury-induced gene 283 protein
• nin283
• NIN283E3 ubiquitin-protein ligase ZNRF1
• zinc and ring finger 1
• zinc and ring finger protein 1
• Zinc/RING finger protein 1

Background

In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNRF1
• Entrez:
  • 84937(Human)
• Uniprot:
  • NP_115644.1(Human)