ZNHIT2 Antibody (4G11) - Azide and BSA Free

Sandwich ELISA: ZNHIT2 Antibody (4G11) [H00000741-M05] - Detection limit for recombinant GST tagged ZNHIT2 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 4G11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNHIT2 Antibody (4G11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ZNHIT2 (NP_055020.1, 274 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEAALTPLALDC
• Specificity: ZNHIT2 - zinc finger, HIT type 2 (4G11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNHIT2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNHIT2 Antibody (4G11) - Azide and BSA Free

• C11orf5zinc finger HIT domain-containing protein 2
• chromosome 11 open reading frame 5
• FONMGC120286
• MGC120285
• Protein FON
• zinc finger, HIT domain containing 2
• zinc finger, HIT type 2
• zinc finger, HIT-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNHIT2
• Entrez:
  • 741(Human)
• Uniprot:
  • NP_055020(Human)