ZNF77 Antibody


Immunocytochemistry/ Immunofluorescence: ZNF77 Antibody [NBP1-80873] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: ZNF77 Antibody [NBP1-80873] - Staining of human lung shows strong cytoplasmic positivity in subsets of alveolar cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC

Order Details

ZNF77 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RPCKECGQACSCLSCQSPPMKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF77 Recombinant Protein Antigen (NBP1-80873PEP)
Read Publication using
NBP1-80873 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF77 Antibody

  • pT1
  • zinc finger protein 77 (pT1)
  • zinc finger protein 77
  • ZNFpT1


ZNF77 may be involved in transcriptional regulation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF77 Antibody (NBP1-80873)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-80873 Applications Species
Wasser, Y, Y The Role of Dlk1 in the Gene Regulatory Network Underlying Motor Neuron Diversification Thesis 2022-01-01 (WB, Mouse) WB Mouse

Reviews for ZNF77 Antibody (NBP1-80873) (0)

There are no reviews for ZNF77 Antibody (NBP1-80873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF77 Antibody (NBP1-80873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF77 Antibody and receive a gift card or discount.


Gene Symbol ZNF77