ZNF750 Antibody - BSA Free

Western Blot: ZNF750 Antibody [NBP2-86556] - WB Suggested Anti-ZINC FINGER PROTEIN 750 Antibody Titration: 5ug/ml. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

ZNF750 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF750 Antibody - BSA Free (NBP2-86556) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF750. Peptide sequence: NRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF750
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ZNF750 Antibody - BSA Free

• FLJ13841
• FLJ51362
• MGC125667
• MGC125668
• protein ZNF750
• ZFP750
• zinc finger protein 750

Background

The ZNF750 gene encodes a protein with a nuclear localization site and a C2H2 zinc finger domain. Mutations in this gene havebeen associated with seborrhea-like dermatitis with psoriasiform elements. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF750