ZNF574 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF574 Antibody [NBP2-13582] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry: ZNF574 Antibody [NBP2-13582] - Staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF574 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPKAPPLSSSTIHYECVDCKALFASQELWLNHRQTHLRATPTKAPAPVVL GSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVELL L
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF574
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF574 Protein (NBP2-13582PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF574 Antibody

  • FLJ22059
  • FP972
  • zinc finger protein 574

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62667
Species: Hu
Applications: WB
NBP2-13226
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45724
Species: Hu
Applications: WB, IHC
NBP1-77218
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
MAB21363
Species: Hu
Applications: WB, IHC, IP
MAB8396
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84541
Species: Hu
Applications: WB, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-38367
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
AF2885
Species: Mu
Applications: WB
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01081
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00873
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-13582
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF574 Antibody (NBP2-13582) (0)

There are no publications for ZNF574 Antibody (NBP2-13582).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF574 Antibody (NBP2-13582) (0)

There are no reviews for ZNF574 Antibody (NBP2-13582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF574 Antibody (NBP2-13582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF574 Products

Bioinformatics Tool for ZNF574 Antibody (NBP2-13582)

Discover related pathways, diseases and genes to ZNF574 Antibody (NBP2-13582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF574 Antibody (NBP2-13582)

Discover more about diseases related to ZNF574 Antibody (NBP2-13582).
 

Pathways for ZNF574 Antibody (NBP2-13582)

View related products by pathway.

PTMs for ZNF574 Antibody (NBP2-13582)

Learn more about PTMs related to ZNF574 Antibody (NBP2-13582).

Blogs on ZNF574

There are no specific blogs for ZNF574, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF574 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF574