GSPT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: GSPT2 Antibody [NBP1-91971] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Analysis in human cell line PC-3 and human cell line MCF-7.

Staining of human cell line PC-3 shows localization to cytosol.

Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GSPT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GSPT2 Antibody - BSA Free (NBP1-91971) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSPT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GSPT2 Protein (NBP1-91971PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GSPT2 Antibody - BSA Free

• eRF3b
• ERF3BGST2
• eukaryotic peptide chain release factor GTP-binding subunit ERF3B
• Eukaryotic peptide chain release factor subunit 3b
• FLJ10441
• G1 to S phase transition 2
• G1 to S phase transition protein 2 homolog

Background

GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSPT2