Recombinant Human ZNF41 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF41 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-779 of Human ZNF41 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAANGDSPPWSPALAAEGRGSSCEASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFKLEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELWQDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKHTLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHTGEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKPYVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICTECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGKAFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQKSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQIIHTGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF41
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF41 Protein

  • zinc finger protein 296
  • Zinc finger protein 342ZFP296ZNF342

Background

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP2-46538
Species: Hu
Applications: WB, IHC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5158
Species: Hu
Applications: WB, IHC
NBP1-93452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007592-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF41 Recombinant Protein (H00007592-P01) (0)

There are no publications for ZNF41 Recombinant Protein (H00007592-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF41 Recombinant Protein (H00007592-P01) (0)

There are no reviews for ZNF41 Recombinant Protein (H00007592-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF41 Recombinant Protein (H00007592-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF41 Products

Bioinformatics Tool for ZNF41 Recombinant Protein (H00007592-P01)

Discover related pathways, diseases and genes to ZNF41 Recombinant Protein (H00007592-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF41 Recombinant Protein (H00007592-P01)

Discover more about diseases related to ZNF41 Recombinant Protein (H00007592-P01).
 

Pathways for ZNF41 Recombinant Protein (H00007592-P01)

View related products by pathway.

Blogs on ZNF41

There are no specific blogs for ZNF41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Synapsin I Antibody
NB300-104-100ul
ZNF41 Antibody
NBP2-49585
ATRX Antibody
NBP1-83077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF41 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF41