Recombinant Human ZNF41 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related ZNF41 Peptides and Proteins

Order Details


    • Catalog Number
      H00007592-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ZNF41 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-779 of Human ZNF41 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAANGDSPPWSPALAAEGRGSSCEASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFKLEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELWQDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKHTLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHTGEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKPYVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICTECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGKAFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQKSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQIIHTGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ZNF41
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
115.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF41 Protein

  • zinc finger protein 296
  • Zinc finger protein 342ZFP296ZNF342

Background

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB300-104
Species: Hu, Mu, Rt, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-67843
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-65810
Species: Hu
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5158
Species: Hu
Applications: WB, IHC
NBP1-93452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007592-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZNF41 Recombinant Protein (H00007592-P01) (0)

There are no publications for ZNF41 Recombinant Protein (H00007592-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF41 Recombinant Protein (H00007592-P01) (0)

There are no reviews for ZNF41 Recombinant Protein (H00007592-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF41 Recombinant Protein (H00007592-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF41 Products

Bioinformatics Tool for ZNF41 Recombinant Protein (H00007592-P01)

Discover related pathways, diseases and genes to ZNF41 Recombinant Protein (H00007592-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF41 Recombinant Protein (H00007592-P01)

Discover more about diseases related to ZNF41 Recombinant Protein (H00007592-P01).
 

Pathways for ZNF41 Recombinant Protein (H00007592-P01)

View related products by pathway.

Blogs on ZNF41

There are no specific blogs for ZNF41, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF41 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF41