ZNF385 Antibody - BSA Free

Staining of human cell line HaCaT shows localization to cytosol.

Analysis in human cell line RT-4 and human cell line U-251 MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF385 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF385 Antibody - BSA Free (NBP3-25251) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ZNF385 using the following amino acid sequence: PVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEE
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF385A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF385 Antibody - BSA Free

• bA179N14.1
• zinc finger protein 334

Background

Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- ordouble-stranded RNA, or interact with other proteins (Sharma et al., 2004 (PubMed 15527981)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF385A