ZNF385 Antibody

Images

 
Western Blot: ZNF385 Antibody [NBP1-80004] - Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain
Immunohistochemistry-Paraffin: ZNF385 Antibody [NBP1-80004] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF385 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF385. Peptide sequence EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF385A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ZNF385 and was validated on Western Blot and immunohistochemistry.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF385 Antibody

  • bA179N14.1
  • zinc finger protein 334

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-20183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
MAB829
Species: Hu
Applications: WB, IHC
NBP2-20704
Species: Hu
Applications: WB, ICC/IF
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
AF4937
Species: Hu
Applications: WB, IHC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF1085
Species: Mu
Applications: WB, IHC, Neut
H00001994-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP

Publications for ZNF385 Antibody (NBP1-80004) (0)

There are no publications for ZNF385 Antibody (NBP1-80004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF385 Antibody (NBP1-80004) (0)

There are no reviews for ZNF385 Antibody (NBP1-80004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF385 Antibody (NBP1-80004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF385 Products

Bioinformatics Tool for ZNF385 Antibody (NBP1-80004)

Discover related pathways, diseases and genes to ZNF385 Antibody (NBP1-80004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF385 Antibody (NBP1-80004)

Discover more about diseases related to ZNF385 Antibody (NBP1-80004).
 

Pathways for ZNF385 Antibody (NBP1-80004)

View related products by pathway.

Blogs on ZNF385

There are no specific blogs for ZNF385, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF385 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF385A
Uniprot