Recombinant Human ZNF365 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF365 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-276 of Human ZNF365 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTVEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKSHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII

Protein/Peptide Type
Recombinant Protein
Gene
ZNF365

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF365 Protein

  • DKFZp547M223
  • double-stranded RNA-binding zinc finger protein JAZ
  • JAZZfp346
  • Just another zinc finger protein
  • zinc finger protein 346

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-934
Species: Ba
Applications: WB, ELISA, IP
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-83671
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF6380
Species: Mu
Applications: WB
MAB2476
Species: Hu
Applications: WB, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22553
Species: Hu
Applications: WB, ELISA
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81615
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-545
Species: Hu
Applications: WB, IHC-P, IP
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32106
Species: Hu, Mu
Applications: WB, IP
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF365 Recombinant Protein (H00022891-P01) (0)

There are no publications for ZNF365 Recombinant Protein (H00022891-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF365 Recombinant Protein (H00022891-P01) (0)

There are no reviews for ZNF365 Recombinant Protein (H00022891-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF365 Recombinant Protein (H00022891-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF365 Products

Bioinformatics Tool for ZNF365 Recombinant Protein (H00022891-P01)

Discover related pathways, diseases and genes to ZNF365 Recombinant Protein (H00022891-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF365 Recombinant Protein (H00022891-P01)

Discover more about diseases related to ZNF365 Recombinant Protein (H00022891-P01).
 

Pathways for ZNF365 Recombinant Protein (H00022891-P01)

View related products by pathway.

PTMs for ZNF365 Recombinant Protein (H00022891-P01)

Learn more about PTMs related to ZNF365 Recombinant Protein (H00022891-P01).

Blogs on ZNF365

There are no specific blogs for ZNF365, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF365 Antibody
NBP2-30451
IL-23 R Antibody
NB600-1147-0.2ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF365 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF365