Home » ZNF365 » ZNF365 Research Products » Recombinant Human ZNF365 GST (N-Term) Protein

Recombinant Human ZNF365 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human ZNF365 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 147-219 of Human ZNF365

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALN
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF365
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33.77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF365 GST (N-Term) Protein

  • DKFZp547M223
  • double-stranded RNA-binding zinc finger protein JAZ
  • JAZZfp346
  • Just another zinc finger protein
  • zinc finger protein 346

Background

ZNF365 - zinc finger protein 365

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nudel Antibody
(OTI5E11)
NBP2-01086
Western Blot: Nudel Antibody (5E11) [NBP2-01086] Analysis of extracts (35ug) from 9 different cell lines by using anti-Nudel monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Nudel Antibody (5E11) [NBP2-01086] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Nudel.
Immunohistochemistry-Paraffin: Nudel Antibody (5E11) [NBP2-01086] - Staining of paraffin-embedded Human Ovary tissue using anti-Nudel mouse monoclonal antibody.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Uricase Antibody
NB600-934
Western Blot: Uricase Antibody [NB600-934] - Detection of purified Uricase under reducing and non-reducing conditions. Samples of 1 and 0.25 ug of protein per lane were run by SDS-PAGE and reduced samples of purified Uricase contained 4% BME and were boiled for 5 minutes. Protein was transferred to nitrocellulose and probed with Goat anti Uricase. Primary antibody was detected with Dylight 649 conjugated Donkey anti Goat (605-743-125 1:10K 1.5 hr RT in and imaged on the BioRad VersaDoc imaging system.
Western Blot: Uricase Antibody [NB600-934] - Analysis using the HRP conjugate of NB600-934. Detection of Lane 1: purified Uricase under reducing conditions. Detection of Lane 2: purified Uricase under reducing conditions. Detection of Lane 3: purified Uricase under non-reducing conditions. Detection of Lane 4: purified Uricase under non-reducing conditions Load: ~1.0 ug (Detection of Lane 1 and 3) and 0.25 ug (Detection of Lane 2 and 4). Primary antibody: Uricase Peroxidase conjugated Antibody at 1:5,000 overnight at 4C. Secondary antibody: DyLight (TM) 649 goat secondary antibody at 1:10,000 for 90 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: 58 kDa, 58 kDa for Uricase. Other band(s): Uricase splice variants and isoforms.
(1 Publication)
Species: Ba
Applications: WB, ELISA, IP
CNTLN Antibody
NBP1-88795
Western Blot: CNTLN Antibody [NBP1-88795] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CNTLN Antibody [NBP1-88795] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.
Species: Hu
Applications: WB, IHC, IHC-P
TC-PTP/PTPN2
Antibody (252294) [Un ...
MAB1930
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and TS1 mouse helper T cell line. PVDF membrane was probed with 0.5 µg/mL Mouse Anti-Human/Mouse/Rat TC‑PTP Monoclonal Antibody (Catalog # MAB1930) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). For additional reference, Recombinant Human PTP1B (Catalog # 1366-PT) and Recombinant Human TC‑PTP aa 2-314 (Catalog # 1930-PT) (1 ng/lane) were included. A specific band for TC-PTP was detected at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
NDE1 Antibody
(2G11-1C11)
H00054820-M01
Western Blot: NDE1 Antibody (2G11-1C11) [H00054820-M01] - NDE1 monoclonal antibody (M01), clone 2G11-1C11 Analysis of NDE1 expression in Hela.
Immunocytochemistry/Immunofluorescence: NDE1 Antibody (2G11-1C11) [H00054820-M01] - Analysis of monoclonal antibody to NDE1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: NDE1 Antibody (2G11-1C11) [H00054820-M01] - Detection limit for recombinant GST tagged NDE1 is approximately 0.03ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
IL-23R Antibody
NB600-1147
Western Blot: IL-23 R Antibody [NB600-1147] - Analysis of IL-23R in (A) Jurkat and (B) NIH 3T3 cells. 1:500 dilution.
Immunohistochemistry-Paraffin: IL-23 R Antibody [NB600-1147] - Staining of IL-23 Receptor in Human periarterial lymphatic sheath lymphocytes (spleen) at 10 ug/ml. Hematoxylin-eosin counterstain.
Western Blot: IL-23 R Antibody [NB600-1147] - Analysis using IL-23R antibody. Lysate from (A) human Jurkat and (B) Mouse NIH 3T3 cells probed with IL-23R antibody at 0.5 ug/ml.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
DISC1 Antibody
NB110-40773
Immunocytochemistry/Immunofluorescence: DISC1 Antibody [NB110-40773] - DISC1 antibody was tested in PC-12 cells at 1:100 with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 549 (red).
Immunohistochemistry: DISC1 Antibody [NB110-40773] - Staining of DISC1 in human brain neurons and neuropil at 2.5ug/ml. 40X.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
PACAP/ADCYAP1
Antibody [Unconjugate
AF6380
Western blot shows lysates of mouse kidney tissue. PVDF Membrane was probed with 1 µg/mL of Human PACAP/ADCYAP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6380) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PACAP/ADCYAP1 at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2
Species: Mu
Applications: WB
BRCA2 Antibody
NBP1-88361
Immunocytochemistry/Immunofluorescence: BRCA2 Antibody [NBP1-88361] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Flow Cytometry: BRCA2 Antibody [NBP1-88361] - DNA damage induced by low-dose radiation and cfDNAox and cfDNAoxR fragments activates reparation of nuclear DNA. (a) (1) Flow cytometry detection of BRCA2 in irradiated (10cGy) and control cells stained with anti-BRCA2 antibodies and secondary FITC-conjugated antibodies. Gate R encircles the fraction of MSCs with elevated values of FL1- BRCA2; (2) distribution of cells with varying BRCA2 contents. Image collected and cropped by CiteAb from the following publication (hindawi.com/journals/omcl/2017/9515809/), licensed under a CC-BY licence.
(3 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Influenza A H5N1
Antibody (2B7)
NBP2-22605
Western Blot: Influenza A H5N1 Antibody (2B7) [NBP2-22605] - Recombinant protein (50ng) were resolved by SDS-PAGE, transferred to PVDF membrane and probed with anti-Influenza A H5N1/HA1 antibody (1:3000). Proteins were visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.Lane 1.: H7N9-HA1(19-339aa) (A/Anhui/1-BALF_RG45/2013)Lane 2.: H7N9-HA1(1-523aa)(A/Shanghai/JS01/2013)Lane 3.: H5N1-HA1(17-338aa) (A/Vietnam/HN31242/2007)
Western Blot: Influenza A H5N1 Antibody (2B7) [NBP2-22605] - H5N1/HA1 recombinant protein (50ng) were resolved by SDS-PAGE, transferred to PVDF membrane and probed with anti-human H5N1/HA1 antibody (1:3000). Proteins were visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.
ELISA: Influenza A H5N1 Antibody (2B7) [NBP2-22605] - Analysis using ELISA.
Species: V, V-Vi
Applications: WB, ELISA
PSMG1 Antibody
NBP1-36951
Immunocytochemistry/Immunofluorescence: PSMG1 Antibody [NBP1-36951] - analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml), showing Golgi apparatus and some cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml).
Flow Cytometry: PSMG1 Antibody [NBP1-36951] - analysis of paraformaldehyde fixed Jurkat cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: PSMG1 Antibody [NBP1-36951] - analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml), showing cytoplasmic and Golgi apparatus staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml).
(1 Publication)
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
MCRS1 Antibody
H00010445-B01P
Western Blot: MCRS1 Antibody [H00010445-B01P] - Analysis of MCRS1 expression in transfected 293T cell line by MCRS1 polyclonal antibody. Lane 1: MCRS1 transfected lysate(50.82 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MCRS1 Antibody [H00010445-B01P] - Analysis of purified antibody to MCRS1 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: MCRS1 Antibody [H00010445-B01P] - Analysis of purified antibody to MCRS1 on formalin-fixed paraffin-embedded human spleen. (antibody concentration 3 ug/ml)
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
EMSY Antibody
NB100-545
Western Blot: EMSY Antibody [NB100-545] - Detection of Human EMSY by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-EMSY antibody NB100-545 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: EMSY Antibody [NB100-545] - Sample: FFPE section of human stomach carcinoma. Antibody: Affinity purified rabbit anti-EMSY used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: EMSY Antibody [NB100-545] - Nuclear extract (NE) from HeLa cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IP
PTGER4/EP4 Antibody
NLS3898
Immunocytochemistry/Immunofluorescence: PTGER4/EP4 Antibody [NLS3898] - Analysis of anti-PTGER4 / EP4 antibody with transfected cells expressing Prostaglandin E Receptor EP4 at 8 ug/ml.
Immunohistochemistry-Paraffin: PTGER4/EP4 Antibody [NLS3898] - Analysis of anti-PTGER4 / EP4 antibody with human colon, ganglion 8 ug/ml.
Immunocytochemistry/Immunofluorescence: PTGER4/EP4 Antibody [NLS3898] - Analysis of anti-PTGER4 / EP4 antibody with transfection control.
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
RRAGD Antibody
NBP2-32106
Western Blot: RRAGD Antibody [NBP2-32106] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells. Antibodies: Affinity purified rabbit anti-RRAGD antibody NBP2-32106 used for IP at 6 ug per reaction. RRAGD was also immunoprecipitated by rabbit anti-RRAGD antibody BL16070. For blotting immunoprecipitated RRAGD, NBP2-32106 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
Western Blot: RRAGD Antibody [NBP2-32106] - Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-RRAGD antibody NBP2-32106 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Species: Hu, Mu
Applications: WB, IP
PTHLH/PTHrP
Antibody
NBP1-59322
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml
Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.
Species: Hu
Applications: WB, IHC, IHC-P
Uromodulin
Antibody (10.32)
NBP1-50321
Immunohistochemistry-Paraffin: Uromodulin Antibody (10.32) [NBP1-50321] - Human kidney tissue, staining in kidney tubules. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer review.
Immunohistochemistry-Paraffin: Uromodulin Antibody (10.32) [NBP1-50321] - Analysis of anti-UMOD / Uromodulin antibody with human kidney at concentration 20 ug/ml.
(1 Review)
Species: Hu, Ca
Applications: IHC, IHC-Fr, IHC-P, IF
MKKS Antibody
NBP1-92123
Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human urinary bladder.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF365 Partial Recombinant Protein (H00022891-Q01) (0)

There are no publications for ZNF365 Partial Recombinant Protein (H00022891-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF365 Partial Recombinant Protein (H00022891-Q01) (0)

There are no reviews for ZNF365 Partial Recombinant Protein (H00022891-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF365 Partial Recombinant Protein (H00022891-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional ZNF365 Products

Bioinformatics Tool for ZNF365 Partial Recombinant Protein (H00022891-Q01)

Discover related pathways, diseases and genes to ZNF365 Partial Recombinant Protein (H00022891-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF365 Partial Recombinant Protein (H00022891-Q01)

Discover more about diseases related to ZNF365 Partial Recombinant Protein (H00022891-Q01).
 

Pathways for ZNF365 Partial Recombinant Protein (H00022891-Q01)

View related products by pathway.

PTMs for ZNF365 Partial Recombinant Protein (H00022891-Q01)

Learn more about PTMs related to ZNF365 Partial Recombinant Protein (H00022891-Q01).

Blogs on ZNF365

There are no specific blogs for ZNF365, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
NOD2 Antibody (2D9)
NB100-524
Western Blot: IL-23 R Antibody [NB600-1147] - Analysis of IL-23R in (A) Jurkat and (B) NIH 3T3 cells. 1:500 dilution.
IL-23R Antibody
NB600-1147-0.2ml

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF365 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF365