ZNF354C Antibody - BSA Free

Western Blot: ZNF354C Antibody [NBP1-81352] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: ZNF354C Antibody [NBP1-81352] - Staining of human cell line SH-SY5Y shows localization to nuclear membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

ChIP-Exo-Seq composite graph for Anti-ZNF354C (NBP1-81352) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF354C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF354C Antibody - BSA Free (NBP1-81352) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ZNF354C Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF354C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF354C Protein (NBP1-81352PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF354C Antibody - BSA Free

• FLJ10390
• ZFEND
• zinc finger protein 358

Background

ZNF354C may function as a transcription repressor. Suppresses osteogenic effects of RUNX2. Binds to 5'-CCACA-3' core sequence. May be involved in osteoblastic differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF354C Antibody (NBP1-81352)(2)

Publications using NBP1-81352

• Oo JA, Irmer B, G�nther S et al. ZNF354C is a transcriptional repressor that inhibits endothelial angiogenic sprouting Scientific Reports 2020-11-05 [PMID: 33154469] (Human)
• Josipovic I, Pfluger B, Fork C, Vasconez AE. Long noncoding RNA LISPR1 is required for S1P signaling and endothelial cell function. J. Mol. Cell. Cardiol. 2018-01-31 [PMID: 29408197] (Human)

Bioinformatics

• Gene Symbol: ZNF354C