ZNF281 Antibody - BSA Free

Western Blot: ZNF281 Antibody [NBP2-13564] - Analysis in human cell line NTERA-2.

Immunocytochemistry/Immunofluorescence: ZNF281 Antibody [NBP2-13564] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Analysis in human cell line NTERA-2.

ChIP-Exo-Seq composite graph for Anti-ZNF281 (NBP2-13564) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF281 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF281 Antibody - BSA Free (NBP2-13564) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF281
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  ZNF281 Protein (NBP2-13564PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF281 Antibody - BSA Free

• FLJ20557
• GZP1
• ZBP-99
• zinc finger protein 416
• ZNF281
• ZNP-99

Background

This zinc finger protein is involved in transcriptional regulation. It represses the transcription of a number of genes including gastrin and ornithine decarboxylase. It binds to the G-rich box in the enhancer region of these genes and may also complex with Oct4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF281