ZNF268 Antibody (3B4) - Azide and BSA Free

Western Blot: ZNF268 Antibody (3B4) [H00010795-M02] - Analysis of ZNF268 expression in transfected 293T cell line by ZNF268 monoclonal antibody (M02), clone 3B4.Lane 1: ZNF268 transfected lysate (Predicted MW: 108.4 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: ZNF268 Antibody (3B4) [H00010795-M02] - Detection limit for recombinant GST tagged ZNF268 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF268 Antibody (3B4) - Azide and BSA Free Summary

• Immunogen: ZNF268 (NP_003406.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEKVLEWLFISQEQPKITKSWGPLSFMDVFVDF
• Specificity: ZNF268 - zinc finger protein 268 (3B4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNF268
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Sandwich ELISA
  • Western Blot 1:100-1:2000
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF268 Antibody (3B4) - Azide and BSA Free

• zinc finger protein 446
• Zinc finger protein with KRAB and SCAN domains 20
• ZKSCAN20FLJ20626
• ZSCAN30

Background

ZNF268 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF268
• Entrez:
  • 10795(Human)
• Uniprot:
  • NP_003406(Human)