ZNF248 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF248 Antibody [NBP2-48538] - Staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry: ZNF248 Antibody [NBP2-48538] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF248 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFG
Specificity
Specificity of human ZNF248 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF248
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF248 Recombinant Protein Antigen (NBP2-48538PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF248 Antibody

  • bA162G10.3
  • ZNF248 zinc finger protein 248

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88668
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-59679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46835
Species: Hu
Applications: IHC, IHC-P
NBP1-82013
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81345
Species: Hu
Applications: WB, IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-48538
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF248 Antibody (NBP2-48538) (0)

There are no publications for ZNF248 Antibody (NBP2-48538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF248 Antibody (NBP2-48538) (0)

There are no reviews for ZNF248 Antibody (NBP2-48538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF248 Antibody (NBP2-48538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF248 Antibody (NBP2-48538)

Discover related pathways, diseases and genes to ZNF248 Antibody (NBP2-48538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF248

There are no specific blogs for ZNF248, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF248 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF248