ZNF179 Antibody - BSA Free

Western Blot: ZNF179 Antibody [NBP2-86447] - WB Suggested Anti-ZNF179 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: OVCAR-3 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF179 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF179 Antibody - BSA Free (NBP2-86447) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF179. Peptide sequence: REFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF112
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF179 Antibody - BSA Free

• BFPZinc finger protein 179ZNF179Brain finger protein
• FLJ99413
• ring finger protein 112

Background

ZNF179 encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF112