ZMYND11 Antibody - BSA Free

Western Blot: ZMYND11 Antibody [NBP2-86909] - WB Suggested Anti-ZMYND11 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysateZMYND11 is supported by BioGPS gene expression data to be expressed in HepG2

Immunohistochemistry-Paraffin: ZMYND11 Antibody [NBP2-86909] - Rabbit Anti-ZMYND11 Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Immunohistochemistry: ZMYND11 Antibody [NBP2-86909] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

ZMYND11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZMYND11 Antibody - BSA Free (NBP2-86909) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZMYND11. Peptide sequence: KKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZMYND11
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ZMYND11 Antibody - BSA Free

• adenovirus 5 E1A binding protein
• Adenovirus 5 E1A-binding protein
• bone morphogenetic protein receptor-associated molecule 1
• BRAM1
• MGC111056
• MYND domain containing 11
• Protein BS69
• zinc finger MYND domain-containing protein 11
• zinc finger, MYND-type containing 11

Background

ZMYND11 is encoded by this gene was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZMYND11