ZIC3 Antibody (4G6)

Images

 
Western Blot: ZIC3 Antibody (4G6) [H00007547-M04] - detection against Immunogen (36.23 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZIC3 Antibody (4G6) Summary

Immunogen
ZIC3 (NP_003404.1, 182 a.a. - 274 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
Specificity
Zic family member 3 heterotaxy 1 (odd-paired homolog, Drosophila)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZIC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZIC3 Antibody (4G6)

  • Heterotaxy 1
  • HTX1
  • HTXHTX1
  • Zic family member 3 (odd-paired homolog, Drosophila)
  • ZIC3
  • Zinc finger protein 203
  • zinc finger protein ZIC 3
  • ZNF203
  • ZNF203Zinc finger protein of the cerebellum 3

Background

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24607
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF339
Species: Hu
Applications: WB, IHC, Block
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB18401
Species: Mu
Applications: WB, Flow, ICC
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00084107-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for ZIC3 Antibody (H00007547-M04) (0)

There are no publications for ZIC3 Antibody (H00007547-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIC3 Antibody (H00007547-M04) (0)

There are no reviews for ZIC3 Antibody (H00007547-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZIC3 Antibody (H00007547-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZIC3 Products

Bioinformatics Tool for ZIC3 Antibody (H00007547-M04)

Discover related pathways, diseases and genes to ZIC3 Antibody (H00007547-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZIC3 Antibody (H00007547-M04)

Discover more about diseases related to ZIC3 Antibody (H00007547-M04).
 

Pathways for ZIC3 Antibody (H00007547-M04)

View related products by pathway.

PTMs for ZIC3 Antibody (H00007547-M04)

Learn more about PTMs related to ZIC3 Antibody (H00007547-M04).
 

Research Areas for ZIC3 Antibody (H00007547-M04)

Find related products by research area.

Blogs on ZIC3

There are no specific blogs for ZIC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZIC3 Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIC3
Entrez
OMIM
Uniprot