ZIC1 Recombinant Protein Antigen

Images

 
There are currently no images for ZIC1 Protein (NBP1-86833PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZIC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZIC1.

Source: E. coli

Amino Acid Sequence: LGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRNRGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGHLLFPGLHEQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZIC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86833.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZIC1 Recombinant Protein Antigen

  • Zic family member 1 (odd-paired homolog, Drosophila)
  • ZIC1
  • ZICZic family member 1 (odd-paired Drosophila homolog)
  • Zinc finger protein 201
  • Zinc finger protein of the cerebellum 1
  • ZNF201
  • ZNF201zinc finger protein ZIC 1

Background

The Zic-1 gene, which encodes a zinc finger protein, is expressed in the developing or matured central nervous system in a highly restricted manner. The Zic gene is expressed in granule cells that make synaptic contact with Purkinje cells. Clearly Zic-1 is a gene critical to cerebellar pattern formation. The expression of Zic genes is first detected at gastrulation and at neurulation, becomes restricted to the dorsal neural ectoderm and the dorsal paraxial mesoderm. Zic-2 and Zic-3 are highly similar genes, especially in their product's zinc finger motif and by comparison of their genomic organization in that they share common exon-intron boundaries and belong to the same gene family. By comparison in function, Zic-2 is essential for the formation of the brain and Zic-3 is important for right and left axis formation. The Zic-1 gene has been mapped to chromosome 9 in mouse. The 5' flanking region of the Zic-1 gene contains a region-specific enhancer determined to be essential in in vivo and in vitro deletion analysis. The temporal profile of mRNA expression differs for each of the Zic gene products. The Drosophila odd-paired gene is highly homologous to the Zic gene family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24607
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
NBP1-33207
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00084107-M09
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-84346
Species: Hu
Applications: WB
423-F8
Species: Hu, Mu
Applications: BA
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2819
Species: Hu
Applications: ICC, WB
1206-F3
Species: Hu
Applications: BA
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
5036-WN
Species: Hu
Applications: BA, BA

Publications for ZIC1 Protein (NBP1-86833PEP) (0)

There are no publications for ZIC1 Protein (NBP1-86833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIC1 Protein (NBP1-86833PEP) (0)

There are no reviews for ZIC1 Protein (NBP1-86833PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZIC1 Protein (NBP1-86833PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZIC1 Products

Research Areas for ZIC1 Protein (NBP1-86833PEP)

Find related products by research area.

Blogs on ZIC1

There are no specific blogs for ZIC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZIC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIC1