ZIC1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZIC1. Source: E. coli
Amino Acid Sequence: LGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRNRGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGHLLFPGLHEQA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ZIC1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86833. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ZIC1 Recombinant Protein Antigen
Background
The Zic-1 gene, which encodes a zinc finger protein, is expressed in the developing or matured central nervous system in a highly restricted manner. The Zic gene is expressed in granule cells that make synaptic contact with Purkinje cells. Clearly Zic-1 is a gene critical to cerebellar pattern formation. The expression of Zic genes is first detected at gastrulation and at neurulation, becomes restricted to the dorsal neural ectoderm and the dorsal paraxial mesoderm. Zic-2 and Zic-3 are highly similar genes, especially in their product's zinc finger motif and by comparison of their genomic organization in that they share common exon-intron boundaries and belong to the same gene family. By comparison in function, Zic-2 is essential for the formation of the brain and Zic-3 is important for right and left axis formation. The Zic-1 gene has been mapped to chromosome 9 in mouse. The 5' flanking region of the Zic-1 gene contains a region-specific enhancer determined to be essential in in vivo and in vitro deletion analysis. The temporal profile of mRNA expression differs for each of the Zic gene products. The Drosophila odd-paired gene is highly homologous to the Zic gene family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Publications for ZIC1 Protein (NBP1-86833PEP) (0)
There are no publications for ZIC1 Protein (NBP1-86833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZIC1 Protein (NBP1-86833PEP) (0)
There are no reviews for ZIC1 Protein (NBP1-86833PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ZIC1 Protein (NBP1-86833PEP) (0)
Additional ZIC1 Products
Research Areas for ZIC1 Protein (NBP1-86833PEP)
Find related products by research area.
|
Blogs on ZIC1