We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZHX3 Recombinant Protein Antigen

Images

 
There are currently no images for ZHX3 Recombinant Protein Antigen (NBP2-55486PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZHX3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZHX3.

Source: E. coli

Amino Acid Sequence: MFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEGTGGGLLVTQPLMANGLQATSSPLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLLTACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZHX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55486.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZHX3 Recombinant Protein Antigen

  • FLJ93221
  • Sp38
  • zona pellucida binding protein
  • zona pellucida-binding protein 1
  • ZPBP1zona pellucida binding protein 1

Background

ZHX3 encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82956
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB600-244
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB7547
Species: Hu
Applications: ICC, WB
NBP2-19533
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4497
Species: Hu
Applications: Simple Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
H00009242-M01
Species: Hu
Applications: ELISA, WB
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00004605-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-02272
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NB110-41539
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-45485
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-47525
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP1-48308
Species: Bv, Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBC1-22925
Species: Hu
Applications: EnzAct, PAGE
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-55486PEP
Species: Hu
Applications: AC

Publications for ZHX3 Recombinant Protein Antigen (NBP2-55486PEP) (0)

There are no publications for ZHX3 Recombinant Protein Antigen (NBP2-55486PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZHX3 Recombinant Protein Antigen (NBP2-55486PEP) (0)

There are no reviews for ZHX3 Recombinant Protein Antigen (NBP2-55486PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZHX3 Recombinant Protein Antigen (NBP2-55486PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZHX3 Products

Array NBP2-55486PEP

Blogs on ZHX3

There are no specific blogs for ZHX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZHX3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZHX3