Recombinant Human ZHX3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZHX3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 863-955 of Human ZHX3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLET

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZHX3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZHX3 Protein

  • FLJ93221
  • SP38
  • zona pellucida binding protein
  • zona pellucida-binding protein 1
  • ZPBP1zona pellucida binding protein 1

Background

This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB600-244
Species: Hu
Applications: WB, IHC-P
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP2-19533
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4497
Species: Hu
Applications: WB, Simple Western
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89340
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP

Publications for ZHX3 Partial Recombinant Protein (H00023051-Q01) (0)

There are no publications for ZHX3 Partial Recombinant Protein (H00023051-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZHX3 Partial Recombinant Protein (H00023051-Q01) (0)

There are no reviews for ZHX3 Partial Recombinant Protein (H00023051-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZHX3 Partial Recombinant Protein (H00023051-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZHX3 Products

Bioinformatics Tool for ZHX3 Partial Recombinant Protein (H00023051-Q01)

Discover related pathways, diseases and genes to ZHX3 Partial Recombinant Protein (H00023051-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZHX3 Partial Recombinant Protein (H00023051-Q01)

Discover more about diseases related to ZHX3 Partial Recombinant Protein (H00023051-Q01).
 

Pathways for ZHX3 Partial Recombinant Protein (H00023051-Q01)

View related products by pathway.

Blogs on ZHX3

There are no specific blogs for ZHX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PKM2 Antibody
NBP1-48308
ZHX3 Antibody
NB100-68220

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZHX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZHX3