ZNF155 Antibody

Images

 
Western Blot: ZNF155 Antibody [NBP1-80912] - Analysis in control (vector only transfected HEK293T lysate) and ZNF155 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ZNF155 Antibody [NBP1-80912] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF155 Antibody [NBP1-80912] - Staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF155 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSFSDVPIFDLPQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF155
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF155 Protein (NBP1-80912PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF155 Antibody

  • KRAB A domain
  • MGC161655
  • pHZ-96
  • zinc finger protein 155 (pHZ-96)
  • zinc finger protein 155

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB6047
Species: Hu
Applications: ICC, WB
NBP1-81633
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86834
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00094039-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-21020
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
AF1227
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00009910-M05
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-94730
Species: Hu, Mu
Applications: WB
NBP1-82897
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-86885
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NB100-56148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DM1000
Species: Hu
Applications: ELISA
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80912
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF155 Antibody (NBP1-80912) (0)

There are no publications for ZNF155 Antibody (NBP1-80912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF155 Antibody (NBP1-80912) (0)

There are no reviews for ZNF155 Antibody (NBP1-80912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF155 Antibody (NBP1-80912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF155 Products

Bioinformatics Tool for ZNF155 Antibody (NBP1-80912)

Discover related pathways, diseases and genes to ZNF155 Antibody (NBP1-80912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF155

There are no specific blogs for ZNF155, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF155 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF155
Entrez