Home » ZNF155 » ZNF155 Antibodies » ZNF155 Antibody

ZNF155 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZNF155 Antibody [NBP1-80912] - Analysis in control (vector only transfected HEK293T lysate) and ZNF155 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Western Blot: ZNF155 Antibody [NBP1-80912] - Analysis in control (vector only transfected HEK293T lysate) and ZNF155 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ZNF155 Antibody [NBP1-80912] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF155 Antibody [NBP1-80912] - Staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZNF155 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSFSDVPIFDLPQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF155
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF155 Protein (NBP1-80912PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF155 Antibody

  • KRAB A domain
  • MGC161655
  • pHZ-96
  • zinc finger protein 155 (pHZ-96)
  • zinc finger protein 155

Background

ZNF155 may be involved in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

KAP1 [p Ser824]
Antibody
NB100-2350
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - FFPE serial sections of asynchronous HeLa cells treated with EPE (left) anduntreated HeLa cells (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB
Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with EPE (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.
(1 Review)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
RCOR1/CoREST
Antibody (9B3R7)
NBP3-16225
Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Immunohistochemistry of paraffin-embedded rat lung using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Immunohistochemistry of paraffin-embedded human appendix using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Immunohistochemistry of paraffin-embedded mouse brain using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
ZNF267 Antibody
NBP1-81633
Immunocytochemistry/Immunofluorescence: ZNF267 Antibody [NBP1-81633] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZNF267 Antibody [NBP1-81633] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: ZNF267 Antibody [NBP1-81633] - Staining of human lymphoid tissues shows weak cytoplasmic positivity in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZFP95 Antibody
NBP1-86834
Western Blot: ZFP95 Antibody [NBP1-86834] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: ZFP95 Antibody [NBP1-86834] - Staining of human cell line RH-30 shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: ZFP95 Antibody [NBP1-86834] - Staining of human esophagus shows strong cytoplasmic and nuclear membrane positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF101 Antibody
(2D5)
H00094039-M01
Immunocytochemistry/Immunofluorescence: ZNF101 Antibody (2D5) [H00094039-M01] - Analysis of monoclonal antibody to ZNF101 on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: ZNF101 Antibody (2D5) [H00094039-M01] - Analysis of ZNF101 expression in transfected 293T cell line by ZNF101 monoclonal antibody (M01), clone 2D5.Lane 1: ZNF101 transfected lysate(36.5 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: ZNF101 Antibody (2D5) [H00094039-M01] - Detection limit for recombinant GST tagged ZNF101 is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
ZNF501 Antibody
NBP2-21020
Immunocytochemistry/Immunofluorescence: ZNF501 Antibody [NBP2-21020] - ZNF501 antibody detects ZNF501 protein at nucleus by immunofluorescent analysis.Sample: U87-MG cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: ZNF501 protein stained by ZNF501 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: ZNF501 Antibody [NBP2-21020] - Sample (30 ug of whole cell lysate) A: U87-MG 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ZNF501 Antibody [NBP2-21020] - Immunohistochemical analysis of paraffin-embedded OVCA, using antibody at 1:250 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF224 293T Cell
Transient Overexpress ...
H00007767-T01
ZNF224 transfected lysate.
Lane 1: ZNF224 transfected lysate (77.88 KDa) Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB
HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Simple Western: HDAC1 Antibody [NB100-56340] - Simple Western lane view shows a specific band for HDAC1 in 0.5 mg/ml of HEK293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Galectin-4
Antibody (9Z2B5)
NBP3-16249
Immunohistochemistry-Paraffin: Galectin-4 Antibody (9Z2B5) [NBP3-16249] - Immunohistochemistry of paraffin-embedded human appendix using Galectin-4 Rabbit mAb (NBP3-16249) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Galectin-4 Antibody (9Z2B5) [NBP3-16249] - Immunohistochemistry of paraffin-embedded mouse colon using Galectin-4 Rabbit mAb (NBP3-16249) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry: Galectin-4 Antibody (9Z2B5) [NBP3-16249] - Immunofluorescence analysis of rat rectum using Galectin-4 Rabbit mAb (NBP3-16249) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
RABGAP1L Antibody
(2D3)
H00009910-M05
Immunohistochemistry-Paraffin: RABGAP1L Antibody (2D3) [H00009910-M05] - Analysis of monoclonal antibody to RABGAP1L on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Western Blot: RABGAP1L Antibody (2D3) [H00009910-M05] - Analysis of RABGAP1L expression in HepG2 (Cat # L019V1).
ELISA: RABGAP1L Antibody (2D3) [H00009910-M05] - Detection limit for recombinant GST tagged RABGAP1L is 0.03 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
ZNF763 Antibody
NBP2-94730
Western Blot: ZNF763 Antibody [NBP2-94730] - Analysis of extracts of various cell lines, using ZNF763 . Exposure time: 30s.
Western Blot: ZNF763 Antibody [NBP2-94730] - Analysis of extracts of various cell lines, using ZNF763 . Exposure time: 10s.
Species: Hu, Mu
Applications: WB
ZNF436 Antibody
NBP1-82897
Immunocytochemistry/Immunofluorescence: ZNF436 Antibody [NBP1-82897] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining in human cerebral cortex and pancreas tissues using anti-ZNF436 antibody. Corresponding ZNF436 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
UBL5 Antibody
NBP2-86885
Immunohistochemistry-Paraffin: UBL5 Antibody [NBP2-86885] - Rabbit Anti-Ubl5 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Kidney. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.
Western Blot: UBL5 Antibody [NBP2-86885] - WB Suggested Anti-Ubl5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Liver
Immunohistochemistry-Paraffin: UBL5 Antibody [NBP2-86885] - Rabbit Anti-Ubl5 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Testis. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NLRP1/NALP1
Antibody
NB100-56148
Immunohistochemistry: NLRP1/NALP1 Antibody [NB100-56148] - OHT-induced upregulation of Aim2 inflammasome in the retina. NLRP1 antibody labeling (red) in the inner retina; yellow arrows indicate colocalization with RGC neurons (RBPSM+) in the GCL. Image collected and cropped by Citeab from the following publication (Inflammasome Activation Induces Pyroptosis in the Retina Exposed to Ocular Hypertension Injury. Front Mol Neurosci (2019) licensed under a CC-BY licence.
Immunohistochemistry: NLRP1/NALP1 Antibody [NB100-56148] - The NLRP1and NLRP3 proteins localized to distinct cell types in the GCL of naive and NT control retinas: NLRP3 (green) is only expressed in blood vessels (white arrowheads). Twenty four hours after OHT, NLRP3 colocalizes with NLRP1 in RGCs (yellow arrows) and to RBPMS- cells (white arrows). Blue arrowheads denote labeling in RGC axons and dendrites. Bar, 25 um on all panels. Image collected and cropped by Citeab from the following publication (Inflammasome Activation Induces Pyroptosis in the Retina Exposed to Ocular Hypertension Injury. Front Mol Neurosci (2019) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: NLRP1/NALP1 Antibody [NB100-56148] - FFPE normal human tissue sections stained for NALP1 (CARD7/NAC) using NB100-56148 at 1:2000. (A) epidermis, (B) esophagus (C) uterine cervix, and (D) thymus. Hematoxylin-eosin counterstain. In A-C, NALP1 expression is associated with differentiation in stratified epithelial of the skin, esophagus, and cervix.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MMP-10 [HRP]
DM1000
(13 Publications)
Species: Hu
Applications: ELISA
ZNF569 Antibody
NBP2-30747
Immunohistochemistry-Paraffin: ZNF569 Antibody [NBP2-30747] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: ZNF569 Antibody [NBP2-30747] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, the Golgi apparatus & vesicles. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF155 Antibody
NBP1-80912
ZNF155 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF155 Antibody (NBP1-80912) (0)

There are no publications for ZNF155 Antibody (NBP1-80912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF155 Antibody (NBP1-80912) (0)

There are no reviews for ZNF155 Antibody (NBP1-80912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF155 Antibody (NBP1-80912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF155 Products

Bioinformatics Tool for ZNF155 Antibody (NBP1-80912)

Discover related pathways, diseases and genes to ZNF155 Antibody (NBP1-80912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF155

There are no specific blogs for ZNF155, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF155 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF155
Entrez