ZDHHC22 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZDHHC22 Antibody [NBP2-58832] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC22 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC22
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDHHC22 Recombinant Protein Antigen (NBP2-58832PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZDHHC22 Antibody

  • putative palmitoyltransferase ZDHHC22
  • C14orf59
  • zinc finger, DHHC-type containing 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010434-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-56653
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5140
Species: Hu
Applications: IHC
NBP1-92090
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56149
Species: Hu
Applications: WB, IHC, IHC-P, IP
AB-230-NA
Species: Hu
Applications: WB, Neut
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZDHHC22 Antibody (NBP2-58832) (0)

There are no publications for ZDHHC22 Antibody (NBP2-58832).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC22 Antibody (NBP2-58832) (0)

There are no reviews for ZDHHC22 Antibody (NBP2-58832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC22 Antibody (NBP2-58832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC22 Products

Bioinformatics Tool for ZDHHC22 Antibody (NBP2-58832)

Discover related pathways, diseases and genes to ZDHHC22 Antibody (NBP2-58832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC22 Antibody (NBP2-58832)

Discover more about diseases related to ZDHHC22 Antibody (NBP2-58832).
 

Pathways for ZDHHC22 Antibody (NBP2-58832)

View related products by pathway.

PTMs for ZDHHC22 Antibody (NBP2-58832)

Learn more about PTMs related to ZDHHC22 Antibody (NBP2-58832).

Blogs on ZDHHC22

There are no specific blogs for ZDHHC22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC22