![Western Blot: LYPLA2 Antibody [H00011313-B01P] - Analysis of LYPLA2 expression in transfected 293T cell line by LYPLA2 polyclonal antibody. Lane 1: LYPLA2 transfected lysate(25.41 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LYPLA2-Antibody-Western-Blot-H00011313-B01P-img0002.jpg "Western Blot: LYPLA2 Antibody [H00011313-B01P] - Analysis of LYPLA2 expression in transfected 293T cell line by LYPLA2 polyclonal antibody. Lane 1: LYPLA2 transfected lysate(25.41 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | LYPLA2 (NP_009191.1, 1 a.a. - 231 a.a.) full-length human protein. MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | LYPLA2 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LYPLA2 Antibody (H00011313-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LYPLA2 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: LYPLA2 Antibody [H00011313-B01P] - Analysis of purified antibody to LYPLA2 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/LYPLA2-Antibody-Immunocytochemistry-Immunofluorescence-H00011313-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: LYPLA2 Antibody [H00011313-B01P] - Analysis of purified antibody to LYPLA2 on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/PLA2G7_DPLG70_ELISA_161.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/DATA_PLA2G7_DPLG70_ELISA_794.jpg)
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")