ZCCHC8 Antibody

Images

 
Western Blot: ZCCHC8 Antibody [NBP2-86901] - Host: Rabbit. Target Name: Zcchc8. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZCCHC8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat ZCCHC8. Peptide sequence: FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZCCHC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZCCHC8 Antibody

  • DKFZp434E2220
  • zinc finger CCHC domain-containing protein 8
  • zinc finger, CCHC domain containing 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83787
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1574
Species: Hu, Mu
Applications: ICC, IHC, IHC-P, IP, KD, WB
NBP1-89175
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-24597
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-87870
Species: Hu
Applications: IHC, IHC-P
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP1-83032
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6286
Species: Hu
Applications: IHC, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for ZCCHC8 Antibody (NBP2-86901) (0)

There are no publications for ZCCHC8 Antibody (NBP2-86901).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHC8 Antibody (NBP2-86901) (0)

There are no reviews for ZCCHC8 Antibody (NBP2-86901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZCCHC8 Antibody (NBP2-86901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZCCHC8 Products

Bioinformatics Tool for ZCCHC8 Antibody (NBP2-86901)

Discover related pathways, diseases and genes to ZCCHC8 Antibody (NBP2-86901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZCCHC8 Antibody (NBP2-86901)

Discover more about diseases related to ZCCHC8 Antibody (NBP2-86901).

PTMs for ZCCHC8 Antibody (NBP2-86901)

Learn more about PTMs related to ZCCHC8 Antibody (NBP2-86901).

Blogs on ZCCHC8

There are no specific blogs for ZCCHC8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZCCHC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCCHC8