ZC3H7A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZC3H7A Antibody [NBP2-56811] - Staining of human cell line U-251 MG shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC3H7A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGR
Specificity
Specificity of human ZC3H7A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H7A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZC3H7A Recombinant Protein Antigen (NBP2-56811PEP)

Reactivity Notes

Mouse 80%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZC3H7A Antibody

  • FLJ10027
  • FLJ20318
  • HSPC055
  • ZC3H7
  • ZC3HDC7
  • zinc finger CCCH domain-containing protein 7A
  • zinc finger CCCH type domain containing 7
  • zinc finger CCCH-type containing 7
  • zinc finger CCCH-type containing 7A
  • zinc finger CCCH-type domain containing 7
  • zinc-finger protein AY163807

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13665
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB7875
Species: Hu, Mu
Applications: WB
NBP2-83654
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-91249
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-86419
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59007
Species: Hu, Mu, Rt
Applications: WB
NBP2-30746
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85635
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02105
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ZC3H7A Antibody (NBP2-56811) (0)

There are no publications for ZC3H7A Antibody (NBP2-56811).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H7A Antibody (NBP2-56811) (0)

There are no reviews for ZC3H7A Antibody (NBP2-56811). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZC3H7A Antibody (NBP2-56811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZC3H7A Products

Bioinformatics Tool for ZC3H7A Antibody (NBP2-56811)

Discover related pathways, diseases and genes to ZC3H7A Antibody (NBP2-56811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC3H7A Antibody (NBP2-56811)

Discover more about diseases related to ZC3H7A Antibody (NBP2-56811).
 

Pathways for ZC3H7A Antibody (NBP2-56811)

View related products by pathway.

Blogs on ZC3H7A

There are no specific blogs for ZC3H7A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H7A