Recombinant Human ZBTB7A/Pokemon GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human ZBTB7A/Pokemon GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human ZBTB7A
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: ZBTB7A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 37.62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZBTB7A/Pokemon GST (N-Term) Protein

• DKFZp547O146
• Factor binding IST protein 1
• Factor that binds to inducer of short transcripts protein 1
• FBI-1
• FBI-1POK erythroid myeloid ontogenic factor
• FBI1TTF-I-interacting peptide 21
• HIV-1 inducer of short transcripts binding protein
• Leukemia/lymphoma-related factor
• LRF
• LRFHIV-1 1st-binding protein 1
• lymphoma related factor
• MGC99631
• Pokemon
• TIP21
• ZBTB7A
• ZBTB7zinc finger and BTB domain containing 7
• zinc finger and BTB domain containing 7A
• zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein
• zinc finger and BTB domain-containing protein 7A
• Zinc finger protein 857A
• ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor

Background

ZBTB7A( AAH19108, 1 a.a. - 109 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB7A