ZBTB3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZBTB3 Antibody [NBP1-82079] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ZBTB3 Antibody [NBP1-82079] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: ZBTB3 Antibody [NBP1-82079] - Staining in human fallopian tube and pancreas tissues using anti-ZBTB3 antibody. Corresponding ZBTB3 RNA-seq data are presented for the same tissues.

ChIP-Exo-Seq composite graph for Anti-ZBTB3 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

• Reactivity: Hu
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZBTB3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVSAPVPSQAPAPAEAELVQVKVEAIVISDEETDVSDEQPQGPERAFPSGGAVYGAQPSQPEAFEDPGAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZBTB3 Protein (NBP1-82079PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZBTB3 Antibody - BSA Free

• FLJ23392
• zinc finger and BTB domain containing 3
• zinc finger and BTB domain-containing protein 3

Background

ZBTB3 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZBTB3 Antibody (NBP1-82079)(2)

Publications using NBP1-82079

• Wang Z, Liang Q, Qian X et al. An autoimmune pleiotropic SNP modulates IRF5 alternative promoter usage through ZBTB3-mediated chromatin looping Nature communications 2023-03-03 [PMID: 36869052] (Human)
• Kottyan LC, Zoller EE, Bene J et al. The IRF5-TNPO3 association with systemic lupus erythematosus has two components that other autoimmune disorders variably share. Hum. Mol. Genet. 2014-09-08 [PMID: 25205108]

Bioinformatics

• Gene Symbol: ZBTB3