ZBTB3 Antibody

Images

 
Immunohistochemistry-Paraffin: ZBTB3 Antibody [NBP1-82079] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ZBTB3 Antibody [NBP1-82079] - Staining of human fallopian tube shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ZBTB3 Antibody [NBP1-82079] - Staining in human fallopian tube and pancreas tissues using anti-ZBTB3 antibody. Corresponding ZBTB3 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ZBTB3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVSAPVPSQAPAPAEAELVQVKVEAIVISDEETDVSDEQPQGPERAFPSGGAVYGAQPSQPEAFEDPGAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZBTB3 Protein (NBP1-82079PEP)
Publications
Read Publication using NBP1-82079.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBTB3 Antibody

  • FLJ23392
  • zinc finger and BTB domain containing 3
  • zinc finger and BTB domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP2-00817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47252
Species: Mu, Rt, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67561
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P, IP
NBP2-14137
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3894
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
AF2608
Species: Hu
Applications: WB
NBP1-88317
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051450-D01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-31176
Species: Hu, Mu, Po, Sh
Applications: WB, ELISA, IHC, IHC-P

Publications for ZBTB3 Antibody (NBP1-82079)(1)

Reviews for ZBTB3 Antibody (NBP1-82079) (0)

There are no reviews for ZBTB3 Antibody (NBP1-82079). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZBTB3 Antibody (NBP1-82079) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZBTB3 Products

Bioinformatics Tool for ZBTB3 Antibody (NBP1-82079)

Discover related pathways, diseases and genes to ZBTB3 Antibody (NBP1-82079). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB3 Antibody (NBP1-82079)

Discover more about diseases related to ZBTB3 Antibody (NBP1-82079).
 

Pathways for ZBTB3 Antibody (NBP1-82079)

View related products by pathway.

Blogs on ZBTB3

There are no specific blogs for ZBTB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB3