ZAK Antibody

Images

 
Western Blot: ZAK Antibody [NBP1-90367] - Analysis in human cell line U-138 MG.
Immunocytochemistry/ Immunofluorescence: ZAK Antibody [NBP1-90367] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: ZAK Antibody [NBP1-90367] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZAK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKE
Localization
Subcellular
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZAK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZAK Protein (NBP1-90367PEP)
Publications
Read Publication using NBP1-90367.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24807215).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZAK Antibody

  • AZK
  • EC 2.7.11
  • EC 2.7.11.25
  • HCCS-4
  • Human cervical cancer suppressor gene 4 protein
  • Leucine zipper- and sterile alpha motif-containing kinase
  • mitogen-activated protein kinase kinase kinase MLT
  • mixed lineage kinase 7
  • mixed lineage kinase with a leucine zipper and a sterile alpha motif
  • mixed lineage kinase-related kinase MRK-beta
  • Mixed lineage kinase-related kinase
  • MLK7
  • mlklak
  • MLK-like mitogen-activated protein triple kinase
  • MLK-related kinase
  • MLT
  • MLTK
  • MRKcervical cancer suppressor gene 4 protein
  • pk
  • protein kinase
  • sterile alpha motif and leucine zipper containing kinase AZK
  • Sterile alpha motif- and leucine zipper-containing kinase AZK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1396
Species: Hu
Applications: WB
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF842
Species: Hu
Applications: WB
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
H00079092-T01
Species: Hu
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-90367
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZAK Antibody (NBP1-90367)(1)

Reviews for ZAK Antibody (NBP1-90367) (0)

There are no reviews for ZAK Antibody (NBP1-90367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZAK Antibody (NBP1-90367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZAK Products

Bioinformatics Tool for ZAK Antibody (NBP1-90367)

Discover related pathways, diseases and genes to ZAK Antibody (NBP1-90367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZAK Antibody (NBP1-90367)

Discover more about diseases related to ZAK Antibody (NBP1-90367).
 

Pathways for ZAK Antibody (NBP1-90367)

View related products by pathway.

PTMs for ZAK Antibody (NBP1-90367)

Learn more about PTMs related to ZAK Antibody (NBP1-90367).
 

Research Areas for ZAK Antibody (NBP1-90367)

Find related products by research area.

Blogs on ZAK

There are no specific blogs for ZAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZAK
Uniprot