ZAK Antibody

Product Discontinued

ZAK Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKE
• Localization: Subcellular
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZAK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24807215).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZAK Antibody

• AZK
• EC 2.7.11
• EC 2.7.11.25
• HCCS-4
• Human cervical cancer suppressor gene 4 protein
• Leucine zipper- and sterile alpha motif-containing kinase
• mitogen-activated protein kinase kinase kinase MLT
• mixed lineage kinase 7
• mixed lineage kinase with a leucine zipper and a sterile alpha motif
• mixed lineage kinase-related kinase MRK-beta
• Mixed lineage kinase-related kinase
• MLK7
• mlklak
• MLK-like mitogen-activated protein triple kinase
• MLK-related kinase
• MLT
• MLTK
• MRKcervical cancer suppressor gene 4 protein
• pk
• protein kinase
• sterile alpha motif and leucine zipper containing kinase AZK
• Sterile alpha motif- and leucine zipper-containing kinase AZK

Background

ZAK is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZAK Antibody (NBP1-90367)(1)

Publication using NBP1-90367

• Liu J, McCleland M, Stawiski EW et al. Integrated exome and transcriptome sequencing reveals ZAK isoform usage in gastric cancer. Nat Commun 2014-05-08 [PMID: 24807215]

FAQs for ZAK Antibody (NBP1-90367). (Showing 1 - 1 of 1 FAQ).

1. What is the difference between the two ZAK antibodies: NBP1-90367 and NBP1-33137? According to the amino acid sequence, the molecular weight of ZAK-alpha is about 91KDa and ZAK-beta is about 51KDa. NBP1-90367 corresponds to ZAK aa 157-305, which is the common amino acid sequence, so it can detect ZAK-alpha and ZAK-beta simultaneously. In your datasheet, the predicted band size is 51KDa. Additionally, in your or my western blot, I can't detect band in 91KDa. There is only one band in 51KDa. Is it reasonable that the band locating in 51kDa is ZAK-beta?
   • Both of these antibodies were raised to the N-terminal region shared by both isoforms 1&2. NBP1-33137 was generated using a partial recombinant protein containing a sequence within aa 18-254 of the human form. NBP1-90367 was developed to partial recombinant protein corresponding to aa 157-305.Based on the immunogen sequence, both antibodies are predicted to recognize both isoform 1 and isoform 2.  There are two possible reasons why only one band shows on the WBs for each of these antibodies:1. In tested tissues only one isoform is expressed. According to uniprot (http://www.uniprot.org/uniprot/Q9NYL2#expression) Isoform 2 is the predominant form in all tissues, except for liver, in which isoform 1 is more highly expressed.2. These antibodies do indeed recognize only one isoform, despite shared immunogen sequence. We have not, however, tested these antibodies side by side on the same lysates, neither have we performed further specificity testing to rule out reactivity with the other isoform.Please also note that according to uniprot (http://www.uniprot.org/uniprot/Q9NYL2#sequences), there are actually 3 isoforms for MAP3K20, the third one is the shortest, yielding a protein of ~35kDa and NBP1-90367 is not going to recognize this isoform, but NBP1-33137 will.

Bioinformatics

• Gene Symbol: ZAK
• Uniprot:
  • Q9NYL2(Human)