ZAK Antibody

Images

 
Orthogonal Strategies: Western Blot: ZAK Antibody [NBP1-90367] - Analysis in human cell lines U2OS and MCF-7 using anti-AC013461.1 antibody. Corresponding AC013461.1 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: ZAK Antibody [NBP1-90367] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZAK Antibody [NBP1-90367] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZAK Antibody [NBP1-90367] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZAK Antibody [NBP1-90367] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ZAK Antibody [NBP1-90367] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related ZAK Primary Antibodies
Validated by:
       

Orthogonal Strategies

 

Order Details


    • Catalog Number
      NBP1-90367
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZAK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKE
Localization
Subcellular
Specificity
Specificity of human ZAK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZAK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
ZAK Knockout HeLa Cell Lysate
Publications
Read Publication using NBP1-90367.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24807215).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZAK Antibody

  • AZK
  • EC 2.7.11
  • EC 2.7.11.25
  • HCCS-4
  • Human cervical cancer suppressor gene 4 protein
  • Leucine zipper- and sterile alpha motif-containing kinase
  • mitogen-activated protein kinase kinase kinase MLT
  • mixed lineage kinase 7
  • mixed lineage kinase with a leucine zipper and a sterile alpha motif
  • mixed lineage kinase-related kinase MRK-beta
  • Mixed lineage kinase-related kinase
  • MLK7
  • mlklak
  • MLK-like mitogen-activated protein triple kinase
  • MLK-related kinase
  • MLT
  • MLTK
  • MRKcervical cancer suppressor gene 4 protein
  • pk
  • protein kinase
  • sterile alpha motif and leucine zipper containing kinase AZK
  • Sterile alpha motif- and leucine zipper-containing kinase AZK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67293
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
AF2498
Species: Mu
Applications: WB, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP1-89781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
H00079092-P01
Species: Hu
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for ZAK Antibody (NBP1-90367)(1)

Reviews for ZAK Antibody (NBP1-90367) (0)

There are no reviews for ZAK Antibody (NBP1-90367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZAK Antibody (NBP1-90367). (Showing 1 - 1 of 1 FAQ).

  1. What is the difference between the two ZAK antibodies: NBP1-90367 and NBP1-33137? According to the amino acid sequence, the molecular weight of ZAK-alpha is about 91KDa and ZAK-beta is about 51KDa. NBP1-90367 corresponds to ZAK aa 157-305, which is the common amino acid sequence, so it can detect ZAK-alpha and ZAK-beta simultaneously. In your datasheet, the predicted band size is 51KDa. Additionally, in your or my western blot, I can't detect band in 91KDa. There is only one band in 51KDa. Is it reasonable that the band locating in 51kDa is ZAK-beta?
    • Both of these antibodies were raised to the N-terminal region shared by both isoforms 1&2. NBP1-33137 was generated using a partial recombinant protein containing a sequence within aa 18-254 of the human form. NBP1-90367 was developed to partial recombinant protein corresponding to aa 157-305.Based on the immunogen sequence, both antibodies are predicted to recognize both isoform 1 and isoform 2.  There are two possible reasons why only one band shows on the WBs for each of these antibodies:1. In tested tissues only one isoform is expressed. According to uniprot (http://www.uniprot.org/uniprot/Q9NYL2#expression) Isoform 2 is the predominant form in all tissues, except for liver, in which isoform 1 is more highly expressed.2. These antibodies do indeed recognize only one isoform, despite shared immunogen sequence. We have not, however, tested these antibodies side by side on the same lysates, neither have we performed further specificity testing to rule out reactivity with the other isoform.Please also note that according to uniprot (http://www.uniprot.org/uniprot/Q9NYL2#sequences), there are actually 3 isoforms for MAP3K20, the third one is the shortest, yielding a protein of ~35kDa and NBP1-90367 is not going to recognize this isoform, but NBP1-33137 will.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZAK Products

Bioinformatics Tool for ZAK Antibody (NBP1-90367)

Discover related pathways, diseases and genes to ZAK Antibody (NBP1-90367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZAK Antibody (NBP1-90367)

Discover more about diseases related to ZAK Antibody (NBP1-90367).
 

Pathways for ZAK Antibody (NBP1-90367)

View related products by pathway.

PTMs for ZAK Antibody (NBP1-90367)

Learn more about PTMs related to ZAK Antibody (NBP1-90367).
 

Research Areas for ZAK Antibody (NBP1-90367)

Find related products by research area.

Blogs on ZAK

There are no specific blogs for ZAK, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZAK
Uniprot