![Western Blot: YTHDF2 Antibody [H00051441-B01P] - Analysis of YTHDF2 expression in human liver.](http://images.novusbio.com/fullsize/YTHDF2-Antibody-Western-Blot-H00051441-B01P-img0001.jpg "Western Blot: YTHDF2 Antibody [H00051441-B01P] - Analysis of YTHDF2 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | YTHDF2 (NP_057342.2, 1 a.a. - 579 a.a.) full-length human protein. MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | YTHDF2 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot. YTHDF2 Antibody validated for Immunocytochemistry/Immunofluorescence from a verified customer review. |
|
| Reviewed Applications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IF | Human | 10/20/2022 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for YTHDF2 Antibody (H00051441-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YTHDF2 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: YTHDF2 Antibody [H00051441-B01P] - YTHDF2 antibody was used (1:50) for labeling and microscopy analysis of the distribution of YTHDF2 proteins in SUM159 cells. Image from verified customer review.](http://images.novusbio.com/fullsize/YTHDF2-Antibody-Immunocytochemistry-Immunofluorescence-H00051441-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: YTHDF2 Antibody [H00051441-B01P] - YTHDF2 antibody was used (1:50) for labeling and microscopy analysis of the distribution of YTHDF2 proteins in SUM159 cells. Image from verified customer review.")
![Western Blot: YTHDF2 Antibody [H00051441-B01P] - Analysis of YTHDF2 expression in transfected 293T cell line by YTHDF2 polyclonal antibody. Lane 1: YTHDF2 transfected lysate(63.69 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/YTHDF2-Antibody-Western-Blot-H00051441-B01P-img0002.jpg "Western Blot: YTHDF2 Antibody [H00051441-B01P] - Analysis of YTHDF2 expression in transfected 293T cell line by YTHDF2 polyclonal antibody. Lane 1: YTHDF2 transfected lysate(63.69 KDa). Lane 2: Non-transfected lysate.")
![Immunohistochemistry UNC5H3/UNC5C Antibody (200414) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1005_human-unc5h3-mab-clone-200414-immunohistochemistry-1882021132046.jpg)
![BMPR-IB/ALK-6 Antibody (88614) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "BMPR-IB/ALK-6 Antibody (88614) [Unconjugated]")
![Immunohistochemistry Thyroglobulin Antibody (904802) [Unconjugated]](https://images.novusbio.com/images2/Thyroglobulin_MAB8306_Immunohistochemistry_16477.jpg)
![Western Blot Thyroglobulin Antibody (904802) [Unconjugated]](https://images.novusbio.com/images2/Thyroglobulin_MAB8306_Western_Blot_16493.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")
