Yes Antibody


Western Blot: Yes Antibody [NBP1-85369] - Analysis in human cell line U-2 OS.
Immunocytochemistry/ Immunofluorescence: Yes Antibody [NBP1-85369] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Yes Antibody [NBP1-85369] - Staining of human kidney shows moderate cytoplasmic positivity in tubule and glomerular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Yes Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS
Specificity of human Yes antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Yes Lysate (NBP2-65085)
Control Peptide
Yes Protein (NBP1-85369PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Yes Antibody

  • cellular yes-1 protein
  • c-yes
  • EC 2.7.10
  • EC
  • HsT441
  • P61-YES
  • Proto-oncogene c-Yes
  • proto-oncogene tyrosine-protein kinase Yes
  • v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
  • Yamaguchi sarcoma oncogene
  • Yes
  • YES1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Yes Antibody (NBP1-85369) (0)

There are no publications for Yes Antibody (NBP1-85369).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Yes Antibody (NBP1-85369) (0)

There are no reviews for Yes Antibody (NBP1-85369). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Yes Antibody (NBP1-85369) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Yes Products

Bioinformatics Tool for Yes Antibody (NBP1-85369)

Discover related pathways, diseases and genes to Yes Antibody (NBP1-85369). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Yes Antibody (NBP1-85369)

Discover more about diseases related to Yes Antibody (NBP1-85369).

Pathways for Yes Antibody (NBP1-85369)

View related products by pathway.

PTMs for Yes Antibody (NBP1-85369)

Learn more about PTMs related to Yes Antibody (NBP1-85369).

Research Areas for Yes Antibody (NBP1-85369)

Find related products by research area.

Blogs on Yes

There are no specific blogs for Yes, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Yes Antibody and receive a gift card or discount.


Gene Symbol YES1